BLASTX nr result
ID: Mentha29_contig00040878
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00040878 (277 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFV61863.1| NADH dehydrogenase subunit 4 (chloroplast) [Origa... 87 2e-15 gb|AGL45386.1| NdhD (chloroplast) [Sesamum indicum] 86 7e-15 ref|YP_004935717.1| ndhD gene product (chloroplast) [Sesamum ind... 86 7e-15 emb|CCQ71672.1| NADH dehydrogenase subunit 4 (chloroplast) [Salv... 85 9e-15 ref|YP_007353965.1| NADH dehydrogenase subunit 4 (chloroplast) [... 84 2e-14 gb|AGW97746.1| NADH-plastoquinone oxidoreductase subunit 4 (chlo... 83 5e-14 gb|ADD29814.1| NADH-plastoquinone oxidoreductase subunit 4 prote... 83 5e-14 gb|AGM14969.1| NADH dehydrogenase subunit 4, partial (chloroplas... 82 6e-14 ref|YP_008815255.1| NADH-plastoquinone oxidoreductase subunit 4 ... 82 6e-14 ref|YP_008815168.1| NADH-plastoquinone oxidoreductase subunit 4 ... 82 6e-14 ref|YP_008815081.1| NADH-plastoquinone oxidoreductase subunit 4 ... 82 6e-14 ref|YP_008814994.1| NADH-plastoquinone oxidoreductase subunit 4 ... 82 6e-14 ref|YP_008814907.1| NADH-plastoquinone oxidoreductase subunit 4 ... 82 6e-14 gb|AGW99021.1| NADH-plastoquinone oxidoreductase subunit 4 (chlo... 82 6e-14 gb|AGW98937.1| NADH-plastoquinone oxidoreductase subunit 4 (chlo... 82 6e-14 gb|AGW98767.1| NADH-plastoquinone oxidoreductase subunit 4 (chlo... 82 6e-14 gb|AGW98682.1| NADH-plastoquinone oxidoreductase subunit 4 (chlo... 82 6e-14 gb|AGW97238.1| NADH-plastoquinone oxidoreductase subunit 4 (chlo... 82 6e-14 gb|AGW96726.1| NADH-plastoquinone oxidoreductase subunit 4 (chlo... 82 6e-14 ref|YP_087016.1| NADH dehydrogenase subunit 4 [Panax ginseng] gi... 82 6e-14 >gb|AFV61863.1| NADH dehydrogenase subunit 4 (chloroplast) [Origanum vulgare subsp. vulgare] Length = 500 Score = 87.4 bits (215), Expect = 2e-15 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = +2 Query: 2 GPRELFLSISIFLPVLGIGMYPDFILSLSVEKVEVILSNYFYR 130 GPRELFLSISIFLPVLGIGMYPDFILSLSVEKVEVILSNYFYR Sbjct: 458 GPRELFLSISIFLPVLGIGMYPDFILSLSVEKVEVILSNYFYR 500 >gb|AGL45386.1| NdhD (chloroplast) [Sesamum indicum] Length = 501 Score = 85.5 bits (210), Expect = 7e-15 Identities = 41/43 (95%), Positives = 43/43 (100%) Frame = +2 Query: 2 GPRELFLSISIFLPVLGIGMYPDFILSLSVEKVEVILSNYFYR 130 GPRELFLSISIFLPVLGIGMYPDF+LSLSVEKVEVILSN+FYR Sbjct: 459 GPRELFLSISIFLPVLGIGMYPDFVLSLSVEKVEVILSNFFYR 501 >ref|YP_004935717.1| ndhD gene product (chloroplast) [Sesamum indicum] gi|347448346|gb|AEO92757.1| NADH dehydrogenase subunit 4 (chloroplast) [Sesamum indicum] Length = 500 Score = 85.5 bits (210), Expect = 7e-15 Identities = 41/43 (95%), Positives = 43/43 (100%) Frame = +2 Query: 2 GPRELFLSISIFLPVLGIGMYPDFILSLSVEKVEVILSNYFYR 130 GPRELFLSISIFLPVLGIGMYPDF+LSLSVEKVEVILSN+FYR Sbjct: 458 GPRELFLSISIFLPVLGIGMYPDFVLSLSVEKVEVILSNFFYR 500 >emb|CCQ71672.1| NADH dehydrogenase subunit 4 (chloroplast) [Salvia miltiorrhiza] Length = 513 Score = 85.1 bits (209), Expect = 9e-15 Identities = 42/46 (91%), Positives = 44/46 (95%) Frame = +2 Query: 2 GPRELFLSISIFLPVLGIGMYPDFILSLSVEKVEVILSNYFYR*FF 139 GPRELFLSISIFLPVLGIG+YPDF+LSLSVEKVEVILSN FYR FF Sbjct: 467 GPRELFLSISIFLPVLGIGIYPDFVLSLSVEKVEVILSNSFYRSFF 512 >ref|YP_007353965.1| NADH dehydrogenase subunit 4 (chloroplast) [Tectona grandis] gi|438687654|emb|CCP47183.1| NADH dehydrogenase subunit 4 (chloroplast) [Tectona grandis] gi|438688338|emb|CCP47272.1| NADH dehydrogenase subunit 4 (chloroplast) [Tectona grandis] gi|438688462|emb|CCP47361.1| NADH dehydrogenase subunit 4 (chloroplast) [Tectona grandis] Length = 500 Score = 84.3 bits (207), Expect = 2e-14 Identities = 40/43 (93%), Positives = 43/43 (100%) Frame = +2 Query: 2 GPRELFLSISIFLPVLGIGMYPDFILSLSVEKVEVILSNYFYR 130 GPRELFLSISIFLPVLGIGMYPDF+LSLSVE+VEVILSN+FYR Sbjct: 458 GPRELFLSISIFLPVLGIGMYPDFVLSLSVERVEVILSNFFYR 500 >gb|AGW97746.1| NADH-plastoquinone oxidoreductase subunit 4 (chloroplast) [Ipomoea pedicellaris] Length = 503 Score = 82.8 bits (203), Expect = 5e-14 Identities = 40/46 (86%), Positives = 43/46 (93%) Frame = +2 Query: 2 GPRELFLSISIFLPVLGIGMYPDFILSLSVEKVEVILSNYFYR*FF 139 GPRELFLSISI LPV+GIGMYPDF+LSLSVEKVEVILSN+FYR F Sbjct: 458 GPRELFLSISILLPVIGIGMYPDFVLSLSVEKVEVILSNFFYRQVF 503 >gb|ADD29814.1| NADH-plastoquinone oxidoreductase subunit 4 protein [Lonicera japonica] Length = 500 Score = 82.8 bits (203), Expect = 5e-14 Identities = 38/43 (88%), Positives = 43/43 (100%) Frame = +2 Query: 2 GPRELFLSISIFLPVLGIGMYPDFILSLSVEKVEVILSNYFYR 130 GPRELF+SISIFLP+LGIGMYPDF+LSLSV+KVEVILSN+FYR Sbjct: 458 GPRELFVSISIFLPILGIGMYPDFVLSLSVDKVEVILSNFFYR 500 >gb|AGM14969.1| NADH dehydrogenase subunit 4, partial (chloroplast) [Panax ginseng] gi|506444495|gb|AGM15055.1| NADH dehydrogenase subunit 4, partial (chloroplast) [Panax ginseng] gi|506444611|gb|AGM15141.1| NADH dehydrogenase subunit 4, partial (chloroplast) [Panax ginseng] Length = 500 Score = 82.4 bits (202), Expect = 6e-14 Identities = 38/43 (88%), Positives = 43/43 (100%) Frame = +2 Query: 2 GPRELFLSISIFLPVLGIGMYPDFILSLSVEKVEVILSNYFYR 130 GPRELF+SISIFLPV+GIGMYPDF+LSLSV+KVEVILSN+FYR Sbjct: 458 GPRELFVSISIFLPVIGIGMYPDFVLSLSVDKVEVILSNFFYR 500 >ref|YP_008815255.1| NADH-plastoquinone oxidoreductase subunit 4 (chloroplast) [Kalopanax septemlobus] gi|458599663|gb|AGG39355.1| NADH-plastoquinone oxidoreductase subunit 4 (chloroplast) [Kalopanax septemlobus] Length = 492 Score = 82.4 bits (202), Expect = 6e-14 Identities = 38/43 (88%), Positives = 43/43 (100%) Frame = +2 Query: 2 GPRELFLSISIFLPVLGIGMYPDFILSLSVEKVEVILSNYFYR 130 GPRELF+SISIFLPV+GIGMYPDF+LSLSV+KVEVILSN+FYR Sbjct: 450 GPRELFVSISIFLPVIGIGMYPDFVLSLSVDKVEVILSNFFYR 492 >ref|YP_008815168.1| NADH-plastoquinone oxidoreductase subunit 4 (chloroplast) [Schefflera delavayi] gi|458599575|gb|AGG39268.1| NADH-plastoquinone oxidoreductase subunit 4 (chloroplast) [Schefflera delavayi] Length = 492 Score = 82.4 bits (202), Expect = 6e-14 Identities = 38/43 (88%), Positives = 43/43 (100%) Frame = +2 Query: 2 GPRELFLSISIFLPVLGIGMYPDFILSLSVEKVEVILSNYFYR 130 GPRELF+SISIFLPV+GIGMYPDF+LSLSV+KVEVILSN+FYR Sbjct: 450 GPRELFVSISIFLPVIGIGMYPDFVLSLSVDKVEVILSNFFYR 492 >ref|YP_008815081.1| NADH-plastoquinone oxidoreductase subunit 4 (chloroplast) [Metapanax delavayi] gi|458599422|gb|AGG39181.1| NADH-plastoquinone oxidoreductase subunit 4 (chloroplast) [Metapanax delavayi] Length = 492 Score = 82.4 bits (202), Expect = 6e-14 Identities = 38/43 (88%), Positives = 43/43 (100%) Frame = +2 Query: 2 GPRELFLSISIFLPVLGIGMYPDFILSLSVEKVEVILSNYFYR 130 GPRELF+SISIFLPV+GIGMYPDF+LSLSV+KVEVILSN+FYR Sbjct: 450 GPRELFVSISIFLPVIGIGMYPDFVLSLSVDKVEVILSNFFYR 492 >ref|YP_008814994.1| NADH-plastoquinone oxidoreductase subunit 4 (chloroplast) [Brassaiopsis hainla] gi|458599243|gb|AGG39094.1| NADH-plastoquinone oxidoreductase subunit 4 (chloroplast) [Brassaiopsis hainla] Length = 492 Score = 82.4 bits (202), Expect = 6e-14 Identities = 38/43 (88%), Positives = 43/43 (100%) Frame = +2 Query: 2 GPRELFLSISIFLPVLGIGMYPDFILSLSVEKVEVILSNYFYR 130 GPRELF+SISIFLPV+GIGMYPDF+LSLSV+KVEVILSN+FYR Sbjct: 450 GPRELFVSISIFLPVIGIGMYPDFVLSLSVDKVEVILSNFFYR 492 >ref|YP_008814907.1| NADH-plastoquinone oxidoreductase subunit 4 (chloroplast) [Aralia undulata] gi|458599141|gb|AGG39007.1| NADH-plastoquinone oxidoreductase subunit 4 (chloroplast) [Aralia undulata] Length = 492 Score = 82.4 bits (202), Expect = 6e-14 Identities = 38/43 (88%), Positives = 43/43 (100%) Frame = +2 Query: 2 GPRELFLSISIFLPVLGIGMYPDFILSLSVEKVEVILSNYFYR 130 GPRELF+SISIFLPV+GIGMYPDF+LSLSV+KVEVILSN+FYR Sbjct: 450 GPRELFVSISIFLPVIGIGMYPDFVLSLSVDKVEVILSNFFYR 492 >gb|AGW99021.1| NADH-plastoquinone oxidoreductase subunit 4 (chloroplast) [Turbina corymbosa] Length = 503 Score = 82.4 bits (202), Expect = 6e-14 Identities = 39/43 (90%), Positives = 42/43 (97%) Frame = +2 Query: 2 GPRELFLSISIFLPVLGIGMYPDFILSLSVEKVEVILSNYFYR 130 GPRELFLSISI LPV+GIGMYPDF+LSLSVEKVEVILSN+FYR Sbjct: 458 GPRELFLSISILLPVIGIGMYPDFVLSLSVEKVEVILSNFFYR 500 >gb|AGW98937.1| NADH-plastoquinone oxidoreductase subunit 4 (chloroplast) [Stictocardia macalusoi] Length = 503 Score = 82.4 bits (202), Expect = 6e-14 Identities = 39/43 (90%), Positives = 42/43 (97%) Frame = +2 Query: 2 GPRELFLSISIFLPVLGIGMYPDFILSLSVEKVEVILSNYFYR 130 GPRELFLSISI LPV+GIGMYPDF+LSLSVEKVEVILSN+FYR Sbjct: 458 GPRELFLSISILLPVIGIGMYPDFVLSLSVEKVEVILSNFFYR 500 >gb|AGW98767.1| NADH-plastoquinone oxidoreductase subunit 4 (chloroplast) [Merremia quinquefolia] Length = 503 Score = 82.4 bits (202), Expect = 6e-14 Identities = 39/43 (90%), Positives = 42/43 (97%) Frame = +2 Query: 2 GPRELFLSISIFLPVLGIGMYPDFILSLSVEKVEVILSNYFYR 130 GPRELFLSISI LPV+GIGMYPDF+LSLSVEKVEVILSN+FYR Sbjct: 458 GPRELFLSISILLPVIGIGMYPDFVLSLSVEKVEVILSNFFYR 500 >gb|AGW98682.1| NADH-plastoquinone oxidoreductase subunit 4 (chloroplast) [Ipomoea pes-tigridis] Length = 503 Score = 82.4 bits (202), Expect = 6e-14 Identities = 39/43 (90%), Positives = 42/43 (97%) Frame = +2 Query: 2 GPRELFLSISIFLPVLGIGMYPDFILSLSVEKVEVILSNYFYR 130 GPRELFLSISI LPV+GIGMYPDF+LSLSVEKVEVILSN+FYR Sbjct: 458 GPRELFLSISILLPVIGIGMYPDFVLSLSVEKVEVILSNFFYR 500 >gb|AGW97238.1| NADH-plastoquinone oxidoreductase subunit 4 (chloroplast) [Ipomoea eriocarpa] gi|546353513|gb|AGW97408.1| NADH-plastoquinone oxidoreductase subunit 4 (chloroplast) [Ipomoea involucrata] Length = 503 Score = 82.4 bits (202), Expect = 6e-14 Identities = 39/43 (90%), Positives = 42/43 (97%) Frame = +2 Query: 2 GPRELFLSISIFLPVLGIGMYPDFILSLSVEKVEVILSNYFYR 130 GPRELFLSISI LPV+GIGMYPDF+LSLSVEKVEVILSN+FYR Sbjct: 458 GPRELFLSISILLPVIGIGMYPDFVLSLSVEKVEVILSNFFYR 500 >gb|AGW96726.1| NADH-plastoquinone oxidoreductase subunit 4 (chloroplast) [Argyreia nervosa] Length = 503 Score = 82.4 bits (202), Expect = 6e-14 Identities = 39/43 (90%), Positives = 42/43 (97%) Frame = +2 Query: 2 GPRELFLSISIFLPVLGIGMYPDFILSLSVEKVEVILSNYFYR 130 GPRELFLSISI LPV+GIGMYPDF+LSLSVEKVEVILSN+FYR Sbjct: 458 GPRELFLSISILLPVIGIGMYPDFVLSLSVEKVEVILSNFFYR 500 >ref|YP_087016.1| NADH dehydrogenase subunit 4 [Panax ginseng] gi|68052547|sp|Q68RV6.1|NU4C_PANGI RecName: Full=NAD(P)H-quinone oxidoreductase chain 4, chloroplastic; AltName: Full=NAD(P)H dehydrogenase, chain 4; AltName: Full=NADH-plastoquinone oxidoreductase chain 4 gi|51235364|gb|AAT98560.1| NADH dehydrogenase subunit 4 [Panax ginseng] Length = 500 Score = 82.4 bits (202), Expect = 6e-14 Identities = 38/43 (88%), Positives = 43/43 (100%) Frame = +2 Query: 2 GPRELFLSISIFLPVLGIGMYPDFILSLSVEKVEVILSNYFYR 130 GPRELF+SISIFLPV+GIGMYPDF+LSLSV+KVEVILSN+FYR Sbjct: 458 GPRELFVSISIFLPVIGIGMYPDFVLSLSVDKVEVILSNFFYR 500