BLASTX nr result
ID: Mentha29_contig00040724
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00040724 (439 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU24863.1| hypothetical protein MIMGU_mgv1a005316mg [Mimulus... 80 8e-26 ref|XP_003540337.1| PREDICTED: diacylglycerol kinase 5-like isof... 75 5e-25 ref|XP_007149903.1| hypothetical protein PHAVU_005G108700g [Phas... 77 5e-25 gb|EYU26096.1| hypothetical protein MIMGU_mgv1a005244mg [Mimulus... 79 6e-25 ref|XP_007043463.1| Diacylglycerol kinase 5 isoform 1 [Theobroma... 72 6e-25 ref|XP_004248144.1| PREDICTED: diacylglycerol kinase iota-like [... 77 1e-24 ref|XP_002518000.1| diacylglycerol kinase, alpha, putative [Rici... 72 2e-24 ref|XP_006365993.1| PREDICTED: diacylglycerol kinase 5-like isof... 77 3e-24 ref|XP_006365994.1| PREDICTED: diacylglycerol kinase 5-like isof... 77 3e-24 ref|XP_006365995.1| PREDICTED: diacylglycerol kinase 5-like isof... 77 3e-24 gb|AFK41745.1| unknown [Medicago truncatula] 69 7e-24 ref|XP_004487339.1| PREDICTED: diacylglycerol kinase delta-like ... 71 9e-24 ref|XP_006409028.1| hypothetical protein EUTSA_v10001971mg [Eutr... 71 2e-23 gb|AHW50676.1| diacylglycerol kinase [Nicotiana tabacum] 72 3e-23 ref|NP_850007.1| diacylglycerol kinase 5 [Arabidopsis thaliana] ... 71 5e-23 gb|AAM62810.1| putative diacylglycerol kinase [Arabidopsis thali... 71 5e-23 ref|NP_565492.1| diacylglycerol kinase 5 [Arabidopsis thaliana] ... 71 5e-23 ref|XP_006357549.1| PREDICTED: diacylglycerol kinase 5-like isof... 71 9e-23 ref|XP_006357547.1| PREDICTED: diacylglycerol kinase 5-like isof... 71 9e-23 gb|AAG23131.1| diacylglycerol kinase variant B [Solanum lycopers... 71 9e-23 >gb|EYU24863.1| hypothetical protein MIMGU_mgv1a005316mg [Mimulus guttatus] Length = 489 Score = 80.1 bits (196), Expect(2) = 8e-26 Identities = 40/83 (48%), Positives = 45/83 (54%) Frame = -1 Query: 439 ICKVKIMKKHGDWQDLQIPSRSYYGLL*EKSNRVRHFYPFFHAVP*NSMYYFCSIRSIVC 260 +CKVK+MK+HGDWQDL +P SIRSIVC Sbjct: 294 LCKVKVMKRHGDWQDLDVPH---------------------------------SIRSIVC 320 Query: 259 LNLPSFSGGLNPWGVPNPRRRRD 191 LNLPSFSGGLNPWG PN +RRD Sbjct: 321 LNLPSFSGGLNPWGTPNSNKRRD 343 Score = 62.8 bits (151), Expect(2) = 8e-26 Identities = 25/31 (80%), Positives = 30/31 (96%) Frame = -2 Query: 93 REFTPPYVDDGLLEVVGFKDAWHGLVLLAPN 1 R+ TPP+VDDGL+E+VGF+DAWHGLVLLAPN Sbjct: 344 RDLTPPFVDDGLIEIVGFRDAWHGLVLLAPN 374 >ref|XP_003540337.1| PREDICTED: diacylglycerol kinase 5-like isoform X1 [Glycine max] gi|571494383|ref|XP_006592834.1| PREDICTED: diacylglycerol kinase 5-like isoform X2 [Glycine max] Length = 488 Score = 75.5 bits (184), Expect(2) = 5e-25 Identities = 40/83 (48%), Positives = 44/83 (53%) Frame = -1 Query: 439 ICKVKIMKKHGDWQDLQIPSRSYYGLL*EKSNRVRHFYPFFHAVP*NSMYYFCSIRSIVC 260 + KVK+MK HG W+DLQIPS SIRSIVC Sbjct: 294 LAKVKVMKTHGGWEDLQIPS---------------------------------SIRSIVC 320 Query: 259 LNLPSFSGGLNPWGVPNPRRRRD 191 LNLPSFSGGLNPWG PN +RRD Sbjct: 321 LNLPSFSGGLNPWGTPNKMKRRD 343 Score = 64.7 bits (156), Expect(2) = 5e-25 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = -2 Query: 93 REFTPPYVDDGLLEVVGFKDAWHGLVLLAPN 1 R+ TPPYVDDGL+EVVGF+DAWHGLVLLAPN Sbjct: 344 RDLTPPYVDDGLIEVVGFRDAWHGLVLLAPN 374 >ref|XP_007149903.1| hypothetical protein PHAVU_005G108700g [Phaseolus vulgaris] gi|561023167|gb|ESW21897.1| hypothetical protein PHAVU_005G108700g [Phaseolus vulgaris] Length = 423 Score = 76.6 bits (187), Expect(2) = 5e-25 Identities = 41/83 (49%), Positives = 44/83 (53%) Frame = -1 Query: 439 ICKVKIMKKHGDWQDLQIPSRSYYGLL*EKSNRVRHFYPFFHAVP*NSMYYFCSIRSIVC 260 I KVK+MK+HG WQDL IPS SIRSIVC Sbjct: 295 IAKVKVMKRHGHWQDLPIPS---------------------------------SIRSIVC 321 Query: 259 LNLPSFSGGLNPWGVPNPRRRRD 191 LNLPSFSGGLNPWG PN +RRD Sbjct: 322 LNLPSFSGGLNPWGTPNKHKRRD 344 Score = 63.5 bits (153), Expect(2) = 5e-25 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = -2 Query: 93 REFTPPYVDDGLLEVVGFKDAWHGLVLLAPN 1 R+ TPPYVDDGL+EVVGF+DAWHGLVLL+PN Sbjct: 345 RDLTPPYVDDGLIEVVGFRDAWHGLVLLSPN 375 >gb|EYU26096.1| hypothetical protein MIMGU_mgv1a005244mg [Mimulus guttatus] Length = 492 Score = 79.0 bits (193), Expect(2) = 6e-25 Identities = 41/82 (50%), Positives = 44/82 (53%) Frame = -1 Query: 439 ICKVKIMKKHGDWQDLQIPSRSYYGLL*EKSNRVRHFYPFFHAVP*NSMYYFCSIRSIVC 260 +CKVK+MKKHGDW DL+IP SIRSIVC Sbjct: 298 LCKVKVMKKHGDWHDLRIPH---------------------------------SIRSIVC 324 Query: 259 LNLPSFSGGLNPWGVPNPRRRR 194 LNLPSFSGGLNPWG PN RRR Sbjct: 325 LNLPSFSGGLNPWGTPNTNRRR 346 Score = 60.8 bits (146), Expect(2) = 6e-25 Identities = 28/39 (71%), Positives = 33/39 (84%), Gaps = 2/39 (5%) Frame = -2 Query: 111 PQTDGQR--EFTPPYVDDGLLEVVGFKDAWHGLVLLAPN 1 P T+ +R + TPP+VDDGL+EVVGFKDAWHGLVLLA N Sbjct: 340 PNTNRRRYKDLTPPFVDDGLIEVVGFKDAWHGLVLLAKN 378 >ref|XP_007043463.1| Diacylglycerol kinase 5 isoform 1 [Theobroma cacao] gi|590690272|ref|XP_007043464.1| Diacylglycerol kinase 5 isoform 1 [Theobroma cacao] gi|508707398|gb|EOX99294.1| Diacylglycerol kinase 5 isoform 1 [Theobroma cacao] gi|508707399|gb|EOX99295.1| Diacylglycerol kinase 5 isoform 1 [Theobroma cacao] Length = 488 Score = 72.0 bits (175), Expect(2) = 6e-25 Identities = 39/83 (46%), Positives = 43/83 (51%) Frame = -1 Query: 439 ICKVKIMKKHGDWQDLQIPSRSYYGLL*EKSNRVRHFYPFFHAVP*NSMYYFCSIRSIVC 260 + KVKIMK+HG WQDL IP SIRSIVC Sbjct: 292 LAKVKIMKRHGQWQDLHIPH---------------------------------SIRSIVC 318 Query: 259 LNLPSFSGGLNPWGVPNPRRRRD 191 LNLPSFSGGLNPWG P+ R+ RD Sbjct: 319 LNLPSFSGGLNPWGTPSGRKLRD 341 Score = 67.8 bits (164), Expect(2) = 6e-25 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = -2 Query: 93 REFTPPYVDDGLLEVVGFKDAWHGLVLLAPN 1 R+FTPPYVDDGLLEVVGF+DAWHGLVLLAPN Sbjct: 342 RDFTPPYVDDGLLEVVGFRDAWHGLVLLAPN 372 >ref|XP_004248144.1| PREDICTED: diacylglycerol kinase iota-like [Solanum lycopersicum] Length = 493 Score = 77.0 bits (188), Expect(2) = 1e-24 Identities = 41/83 (49%), Positives = 44/83 (53%) Frame = -1 Query: 439 ICKVKIMKKHGDWQDLQIPSRSYYGLL*EKSNRVRHFYPFFHAVP*NSMYYFCSIRSIVC 260 + KVKIMKKHG+WQDL IP SIRSIVC Sbjct: 297 LAKVKIMKKHGEWQDLDIPP---------------------------------SIRSIVC 323 Query: 259 LNLPSFSGGLNPWGVPNPRRRRD 191 LNLPSFSGGLNPWG PN +RRD Sbjct: 324 LNLPSFSGGLNPWGTPNSNKRRD 346 Score = 62.0 bits (149), Expect(2) = 1e-24 Identities = 25/31 (80%), Positives = 30/31 (96%) Frame = -2 Query: 93 REFTPPYVDDGLLEVVGFKDAWHGLVLLAPN 1 R+ TPPYVDDGL+EVVGF++AWHG+VLLAPN Sbjct: 347 RDLTPPYVDDGLIEVVGFRNAWHGMVLLAPN 377 >ref|XP_002518000.1| diacylglycerol kinase, alpha, putative [Ricinus communis] gi|223542982|gb|EEF44518.1| diacylglycerol kinase, alpha, putative [Ricinus communis] Length = 490 Score = 72.4 bits (176), Expect(2) = 2e-24 Identities = 38/83 (45%), Positives = 44/83 (53%) Frame = -1 Query: 439 ICKVKIMKKHGDWQDLQIPSRSYYGLL*EKSNRVRHFYPFFHAVP*NSMYYFCSIRSIVC 260 + KVKIMK+HG WQDL IP SIRSIVC Sbjct: 295 LAKVKIMKRHGQWQDLHIPR---------------------------------SIRSIVC 321 Query: 259 LNLPSFSGGLNPWGVPNPRRRRD 191 LNLPSFSGGL+PWG PN +++RD Sbjct: 322 LNLPSFSGGLSPWGTPNSKKQRD 344 Score = 65.5 bits (158), Expect(2) = 2e-24 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = -2 Query: 93 REFTPPYVDDGLLEVVGFKDAWHGLVLLAPN 1 R+ TPPYVDDGLLEVVGF+DAWHGLVLLAPN Sbjct: 345 RDLTPPYVDDGLLEVVGFRDAWHGLVLLAPN 375 >ref|XP_006365993.1| PREDICTED: diacylglycerol kinase 5-like isoform X1 [Solanum tuberosum] Length = 502 Score = 77.0 bits (188), Expect(2) = 3e-24 Identities = 41/83 (49%), Positives = 44/83 (53%) Frame = -1 Query: 439 ICKVKIMKKHGDWQDLQIPSRSYYGLL*EKSNRVRHFYPFFHAVP*NSMYYFCSIRSIVC 260 + KVKIMKKHG+WQDL IP SIRSIVC Sbjct: 306 LAKVKIMKKHGEWQDLDIPH---------------------------------SIRSIVC 332 Query: 259 LNLPSFSGGLNPWGVPNPRRRRD 191 LNLPSFSGGLNPWG PN +RRD Sbjct: 333 LNLPSFSGGLNPWGTPNSNKRRD 355 Score = 60.5 bits (145), Expect(2) = 3e-24 Identities = 24/31 (77%), Positives = 30/31 (96%) Frame = -2 Query: 93 REFTPPYVDDGLLEVVGFKDAWHGLVLLAPN 1 R+ TPP+VDDGL+EVVGF++AWHG+VLLAPN Sbjct: 356 RDLTPPFVDDGLIEVVGFRNAWHGMVLLAPN 386 >ref|XP_006365994.1| PREDICTED: diacylglycerol kinase 5-like isoform X2 [Solanum tuberosum] Length = 500 Score = 77.0 bits (188), Expect(2) = 3e-24 Identities = 41/83 (49%), Positives = 44/83 (53%) Frame = -1 Query: 439 ICKVKIMKKHGDWQDLQIPSRSYYGLL*EKSNRVRHFYPFFHAVP*NSMYYFCSIRSIVC 260 + KVKIMKKHG+WQDL IP SIRSIVC Sbjct: 304 LAKVKIMKKHGEWQDLDIPH---------------------------------SIRSIVC 330 Query: 259 LNLPSFSGGLNPWGVPNPRRRRD 191 LNLPSFSGGLNPWG PN +RRD Sbjct: 331 LNLPSFSGGLNPWGTPNSNKRRD 353 Score = 60.5 bits (145), Expect(2) = 3e-24 Identities = 24/31 (77%), Positives = 30/31 (96%) Frame = -2 Query: 93 REFTPPYVDDGLLEVVGFKDAWHGLVLLAPN 1 R+ TPP+VDDGL+EVVGF++AWHG+VLLAPN Sbjct: 354 RDLTPPFVDDGLIEVVGFRNAWHGMVLLAPN 384 >ref|XP_006365995.1| PREDICTED: diacylglycerol kinase 5-like isoform X3 [Solanum tuberosum] gi|565400983|ref|XP_006365996.1| PREDICTED: diacylglycerol kinase 5-like isoform X4 [Solanum tuberosum] Length = 493 Score = 77.0 bits (188), Expect(2) = 3e-24 Identities = 41/83 (49%), Positives = 44/83 (53%) Frame = -1 Query: 439 ICKVKIMKKHGDWQDLQIPSRSYYGLL*EKSNRVRHFYPFFHAVP*NSMYYFCSIRSIVC 260 + KVKIMKKHG+WQDL IP SIRSIVC Sbjct: 297 LAKVKIMKKHGEWQDLDIPH---------------------------------SIRSIVC 323 Query: 259 LNLPSFSGGLNPWGVPNPRRRRD 191 LNLPSFSGGLNPWG PN +RRD Sbjct: 324 LNLPSFSGGLNPWGTPNSNKRRD 346 Score = 60.5 bits (145), Expect(2) = 3e-24 Identities = 24/31 (77%), Positives = 30/31 (96%) Frame = -2 Query: 93 REFTPPYVDDGLLEVVGFKDAWHGLVLLAPN 1 R+ TPP+VDDGL+EVVGF++AWHG+VLLAPN Sbjct: 347 RDLTPPFVDDGLIEVVGFRNAWHGMVLLAPN 377 >gb|AFK41745.1| unknown [Medicago truncatula] Length = 484 Score = 69.3 bits (168), Expect(2) = 7e-24 Identities = 37/81 (45%), Positives = 43/81 (53%) Frame = -1 Query: 433 KVKIMKKHGDWQDLQIPSRSYYGLL*EKSNRVRHFYPFFHAVP*NSMYYFCSIRSIVCLN 254 KVK+MK G W+DL+IPS SIRSIVCLN Sbjct: 294 KVKVMKTAGQWEDLEIPS---------------------------------SIRSIVCLN 320 Query: 253 LPSFSGGLNPWGVPNPRRRRD 191 LPSFSGGLNPWG PN +++RD Sbjct: 321 LPSFSGGLNPWGTPNRKKQRD 341 Score = 67.0 bits (162), Expect(2) = 7e-24 Identities = 28/31 (90%), Positives = 31/31 (100%) Frame = -2 Query: 93 REFTPPYVDDGLLEVVGFKDAWHGLVLLAPN 1 R+FTPPYVDDGL+EVVGF+DAWHGLVLLAPN Sbjct: 342 RDFTPPYVDDGLIEVVGFRDAWHGLVLLAPN 372 >ref|XP_004487339.1| PREDICTED: diacylglycerol kinase delta-like isoform X1 [Cicer arietinum] gi|502083010|ref|XP_004487340.1| PREDICTED: diacylglycerol kinase delta-like isoform X2 [Cicer arietinum] gi|502083013|ref|XP_004487341.1| PREDICTED: diacylglycerol kinase delta-like isoform X3 [Cicer arietinum] Length = 489 Score = 71.2 bits (173), Expect(2) = 9e-24 Identities = 39/83 (46%), Positives = 43/83 (51%) Frame = -1 Query: 439 ICKVKIMKKHGDWQDLQIPSRSYYGLL*EKSNRVRHFYPFFHAVP*NSMYYFCSIRSIVC 260 + KVK+MK G W+DLQIPS IRSIVC Sbjct: 295 MAKVKVMKTPGHWEDLQIPS---------------------------------GIRSIVC 321 Query: 259 LNLPSFSGGLNPWGVPNPRRRRD 191 LNLPSFSGGLNPWG PN RR+RD Sbjct: 322 LNLPSFSGGLNPWGTPNRRRQRD 344 Score = 64.7 bits (156), Expect(2) = 9e-24 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = -2 Query: 93 REFTPPYVDDGLLEVVGFKDAWHGLVLLAPN 1 R+ TPPYVDDGL+EVVGF+DAWHGLVLLAPN Sbjct: 345 RDLTPPYVDDGLIEVVGFRDAWHGLVLLAPN 375 >ref|XP_006409028.1| hypothetical protein EUTSA_v10001971mg [Eutrema salsugineum] gi|557110184|gb|ESQ50481.1| hypothetical protein EUTSA_v10001971mg [Eutrema salsugineum] Length = 490 Score = 70.9 bits (172), Expect(2) = 2e-23 Identities = 38/83 (45%), Positives = 42/83 (50%) Frame = -1 Query: 439 ICKVKIMKKHGDWQDLQIPSRSYYGLL*EKSNRVRHFYPFFHAVP*NSMYYFCSIRSIVC 260 + KVKI K+G W DL IP SIRSIVC Sbjct: 294 LAKVKIANKNGQWHDLHIPH---------------------------------SIRSIVC 320 Query: 259 LNLPSFSGGLNPWGVPNPRRRRD 191 LNLPSFSGGLNPWG PNPR++RD Sbjct: 321 LNLPSFSGGLNPWGTPNPRKQRD 343 Score = 63.5 bits (153), Expect(2) = 2e-23 Identities = 26/38 (68%), Positives = 33/38 (86%) Frame = -2 Query: 114 HPQTDGQREFTPPYVDDGLLEVVGFKDAWHGLVLLAPN 1 +P+ R+ TPP+VDDGL+EVVGF++AWHGLVLLAPN Sbjct: 337 NPRKQRDRDLTPPFVDDGLIEVVGFRNAWHGLVLLAPN 374 >gb|AHW50676.1| diacylglycerol kinase [Nicotiana tabacum] Length = 493 Score = 72.4 bits (176), Expect(2) = 3e-23 Identities = 39/82 (47%), Positives = 43/82 (52%) Frame = -1 Query: 439 ICKVKIMKKHGDWQDLQIPSRSYYGLL*EKSNRVRHFYPFFHAVP*NSMYYFCSIRSIVC 260 + KVKIMKK G+WQDLQIP S+RSIVC Sbjct: 299 LTKVKIMKKQGEWQDLQIPH---------------------------------SVRSIVC 325 Query: 259 LNLPSFSGGLNPWGVPNPRRRR 194 LNLPSFSGGLNPWG PN +RR Sbjct: 326 LNLPSFSGGLNPWGTPNNNKRR 347 Score = 61.6 bits (148), Expect(2) = 3e-23 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = -2 Query: 93 REFTPPYVDDGLLEVVGFKDAWHGLVLLAP 4 R+ TPP+VDDGLLEVVGF+DAWHGLVLLAP Sbjct: 349 RDLTPPFVDDGLLEVVGFRDAWHGLVLLAP 378 >ref|NP_850007.1| diacylglycerol kinase 5 [Arabidopsis thaliana] gi|79322579|ref|NP_001031381.1| diacylglycerol kinase 5 [Arabidopsis thaliana] gi|75168938|sp|Q9C5E5.1|DGK5_ARATH RecName: Full=Diacylglycerol kinase 5; Short=AtDGK5; Short=DAG kinase 5; AltName: Full=Diglyceride kinase 5; Short=DGK 5 gi|13430776|gb|AAK26010.1|AF360300_1 putative diacylglycerol kinase [Arabidopsis thaliana] gi|24030462|gb|AAN41383.1| putative diacylglycerol kinase [Arabidopsis thaliana] gi|330251999|gb|AEC07093.1| diacylglycerol kinase 5 [Arabidopsis thaliana] gi|330252002|gb|AEC07096.1| diacylglycerol kinase 5 [Arabidopsis thaliana] Length = 509 Score = 71.2 bits (173), Expect(2) = 5e-23 Identities = 38/83 (45%), Positives = 43/83 (51%) Frame = -1 Query: 439 ICKVKIMKKHGDWQDLQIPSRSYYGLL*EKSNRVRHFYPFFHAVP*NSMYYFCSIRSIVC 260 + KVKI ++G WQDL IP SIRSIVC Sbjct: 294 LAKVKIATRNGQWQDLHIPH---------------------------------SIRSIVC 320 Query: 259 LNLPSFSGGLNPWGVPNPRRRRD 191 LNLPSFSGGLNPWG PNPR++RD Sbjct: 321 LNLPSFSGGLNPWGTPNPRKQRD 343 Score = 62.0 bits (149), Expect(2) = 5e-23 Identities = 26/38 (68%), Positives = 32/38 (84%) Frame = -2 Query: 114 HPQTDGQREFTPPYVDDGLLEVVGFKDAWHGLVLLAPN 1 +P+ R TPP+VDDGL+EVVGF++AWHGLVLLAPN Sbjct: 337 NPRKQRDRGLTPPFVDDGLIEVVGFRNAWHGLVLLAPN 374 >gb|AAM62810.1| putative diacylglycerol kinase [Arabidopsis thaliana] Length = 491 Score = 71.2 bits (173), Expect(2) = 5e-23 Identities = 38/83 (45%), Positives = 43/83 (51%) Frame = -1 Query: 439 ICKVKIMKKHGDWQDLQIPSRSYYGLL*EKSNRVRHFYPFFHAVP*NSMYYFCSIRSIVC 260 + KVKI ++G WQDL IP SIRSIVC Sbjct: 294 LAKVKIATRNGQWQDLHIPH---------------------------------SIRSIVC 320 Query: 259 LNLPSFSGGLNPWGVPNPRRRRD 191 LNLPSFSGGLNPWG PNPR++RD Sbjct: 321 LNLPSFSGGLNPWGTPNPRKQRD 343 Score = 62.0 bits (149), Expect(2) = 5e-23 Identities = 26/38 (68%), Positives = 32/38 (84%) Frame = -2 Query: 114 HPQTDGQREFTPPYVDDGLLEVVGFKDAWHGLVLLAPN 1 +P+ R TPP+VDDGL+EVVGF++AWHGLVLLAPN Sbjct: 337 NPRKQRDRGLTPPFVDDGLIEVVGFRNAWHGLVLLAPN 374 >ref|NP_565492.1| diacylglycerol kinase 5 [Arabidopsis thaliana] gi|42570849|ref|NP_973498.1| diacylglycerol kinase 5 [Arabidopsis thaliana] gi|20197681|gb|AAD20931.2| putative diacylglycerol kinase [Arabidopsis thaliana] gi|222423216|dbj|BAH19585.1| AT2G20900 [Arabidopsis thaliana] gi|222424359|dbj|BAH20135.1| AT2G20900 [Arabidopsis thaliana] gi|330252000|gb|AEC07094.1| diacylglycerol kinase 5 [Arabidopsis thaliana] gi|330252001|gb|AEC07095.1| diacylglycerol kinase 5 [Arabidopsis thaliana] Length = 491 Score = 71.2 bits (173), Expect(2) = 5e-23 Identities = 38/83 (45%), Positives = 43/83 (51%) Frame = -1 Query: 439 ICKVKIMKKHGDWQDLQIPSRSYYGLL*EKSNRVRHFYPFFHAVP*NSMYYFCSIRSIVC 260 + KVKI ++G WQDL IP SIRSIVC Sbjct: 294 LAKVKIATRNGQWQDLHIPH---------------------------------SIRSIVC 320 Query: 259 LNLPSFSGGLNPWGVPNPRRRRD 191 LNLPSFSGGLNPWG PNPR++RD Sbjct: 321 LNLPSFSGGLNPWGTPNPRKQRD 343 Score = 62.0 bits (149), Expect(2) = 5e-23 Identities = 26/38 (68%), Positives = 32/38 (84%) Frame = -2 Query: 114 HPQTDGQREFTPPYVDDGLLEVVGFKDAWHGLVLLAPN 1 +P+ R TPP+VDDGL+EVVGF++AWHGLVLLAPN Sbjct: 337 NPRKQRDRGLTPPFVDDGLIEVVGFRNAWHGLVLLAPN 374 >ref|XP_006357549.1| PREDICTED: diacylglycerol kinase 5-like isoform X3 [Solanum tuberosum] Length = 544 Score = 70.9 bits (172), Expect(2) = 9e-23 Identities = 38/82 (46%), Positives = 42/82 (51%) Frame = -1 Query: 439 ICKVKIMKKHGDWQDLQIPSRSYYGLL*EKSNRVRHFYPFFHAVP*NSMYYFCSIRSIVC 260 + KVKIMKK G+WQDL IP S+RSIVC Sbjct: 328 LTKVKIMKKQGEWQDLHIPP---------------------------------SVRSIVC 354 Query: 259 LNLPSFSGGLNPWGVPNPRRRR 194 LNLPSFSGGLNPWG PN +RR Sbjct: 355 LNLPSFSGGLNPWGTPNSNKRR 376 Score = 61.6 bits (148), Expect(2) = 9e-23 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = -2 Query: 93 REFTPPYVDDGLLEVVGFKDAWHGLVLLAP 4 R+ TPP+VDDGLLEVVGF+DAWHGLVLLAP Sbjct: 378 RDLTPPFVDDGLLEVVGFRDAWHGLVLLAP 407 >ref|XP_006357547.1| PREDICTED: diacylglycerol kinase 5-like isoform X1 [Solanum tuberosum] Length = 522 Score = 70.9 bits (172), Expect(2) = 9e-23 Identities = 38/82 (46%), Positives = 42/82 (51%) Frame = -1 Query: 439 ICKVKIMKKHGDWQDLQIPSRSYYGLL*EKSNRVRHFYPFFHAVP*NSMYYFCSIRSIVC 260 + KVKIMKK G+WQDL IP S+RSIVC Sbjct: 328 LTKVKIMKKQGEWQDLHIPP---------------------------------SVRSIVC 354 Query: 259 LNLPSFSGGLNPWGVPNPRRRR 194 LNLPSFSGGLNPWG PN +RR Sbjct: 355 LNLPSFSGGLNPWGTPNSNKRR 376 Score = 61.6 bits (148), Expect(2) = 9e-23 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = -2 Query: 93 REFTPPYVDDGLLEVVGFKDAWHGLVLLAP 4 R+ TPP+VDDGLLEVVGF+DAWHGLVLLAP Sbjct: 378 RDLTPPFVDDGLLEVVGFRDAWHGLVLLAP 407 >gb|AAG23131.1| diacylglycerol kinase variant B [Solanum lycopersicum] Length = 511 Score = 70.9 bits (172), Expect(2) = 9e-23 Identities = 38/82 (46%), Positives = 42/82 (51%) Frame = -1 Query: 439 ICKVKIMKKHGDWQDLQIPSRSYYGLL*EKSNRVRHFYPFFHAVP*NSMYYFCSIRSIVC 260 + KVKIMKK G+WQDL IP S+RSIVC Sbjct: 295 LTKVKIMKKQGEWQDLHIPP---------------------------------SVRSIVC 321 Query: 259 LNLPSFSGGLNPWGVPNPRRRR 194 LNLPSFSGGLNPWG PN +RR Sbjct: 322 LNLPSFSGGLNPWGTPNSNKRR 343 Score = 61.6 bits (148), Expect(2) = 9e-23 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = -2 Query: 93 REFTPPYVDDGLLEVVGFKDAWHGLVLLAP 4 R+ TPP+VDDGLLEVVGF+DAWHGLVLLAP Sbjct: 345 RDLTPPFVDDGLLEVVGFRDAWHGLVLLAP 374