BLASTX nr result
ID: Mentha29_contig00040713
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00040713 (246 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006339865.1| PREDICTED: protein IRX15-like [Solanum tuber... 104 1e-20 ref|XP_004231869.1| PREDICTED: protein IRX15-like [Solanum lycop... 104 1e-20 ref|XP_006360212.1| PREDICTED: protein IRX15-like [Solanum tuber... 102 4e-20 gb|EPS63094.1| hypothetical protein M569_11690, partial [Genlise... 102 4e-20 ref|XP_004233444.1| PREDICTED: protein IRX15-like [Solanum lycop... 102 4e-20 ref|XP_002866713.1| nucleic acid binding protein [Arabidopsis ly... 92 1e-16 ref|XP_006404049.1| hypothetical protein EUTSA_v10010543mg [Eutr... 91 2e-16 ref|XP_004509113.1| PREDICTED: protein IRX15-like [Cicer arietinum] 91 2e-16 ref|XP_007155898.1| hypothetical protein PHAVU_003G241300g [Phas... 90 3e-16 ref|XP_006393919.1| hypothetical protein EUTSA_v10004623mg [Eutr... 90 3e-16 ref|XP_006280826.1| hypothetical protein CARUB_v10026796mg [Caps... 90 3e-16 ref|NP_201522.1| uncharacterized protein [Arabidopsis thaliana] ... 90 3e-16 ref|XP_002877736.1| hypothetical protein ARALYDRAFT_906343 [Arab... 90 3e-16 gb|ABK28594.1| unknown [Arabidopsis thaliana] 90 3e-16 dbj|BAD94344.1| hypothetical protein [Arabidopsis thaliana] 90 3e-16 gb|AAM64983.1| unknown [Arabidopsis thaliana] 90 3e-16 ref|NP_190591.1| protein IRREGULAR XYLEM 15 [Arabidopsis thalian... 90 3e-16 ref|XP_002533263.1| conserved hypothetical protein [Ricinus comm... 90 4e-16 gb|AFK46333.1| unknown [Lotus japonicus] 89 5e-16 ref|XP_002283187.1| PREDICTED: uncharacterized protein LOC100259... 89 8e-16 >ref|XP_006339865.1| PREDICTED: protein IRX15-like [Solanum tuberosum] Length = 308 Score = 104 bits (260), Expect = 1e-20 Identities = 46/62 (74%), Positives = 57/62 (91%) Frame = +3 Query: 60 PLSAAVSRALIHYASNSNNSDHMSYTDMKQISDALRQCSPPCNLLVFGLTAESLLWRALN 239 PLS AV+RAL+HYASNSNN++HMSYTD+K I+D L++CS PCNLLVFGLT E+LLW+ALN Sbjct: 69 PLSKAVARALVHYASNSNNTEHMSYTDIKHIADVLQKCSQPCNLLVFGLTHETLLWKALN 128 Query: 240 HH 245 H+ Sbjct: 129 HN 130 >ref|XP_004231869.1| PREDICTED: protein IRX15-like [Solanum lycopersicum] Length = 308 Score = 104 bits (260), Expect = 1e-20 Identities = 46/62 (74%), Positives = 57/62 (91%) Frame = +3 Query: 60 PLSAAVSRALIHYASNSNNSDHMSYTDMKQISDALRQCSPPCNLLVFGLTAESLLWRALN 239 PLS AV+RAL+HYASNSNN++HMSYTD+K I+D L++CS PCNLLVFGLT E+LLW+ALN Sbjct: 69 PLSKAVARALVHYASNSNNTEHMSYTDIKHIADVLQKCSQPCNLLVFGLTHETLLWKALN 128 Query: 240 HH 245 H+ Sbjct: 129 HN 130 >ref|XP_006360212.1| PREDICTED: protein IRX15-like [Solanum tuberosum] Length = 302 Score = 102 bits (255), Expect = 4e-20 Identities = 49/65 (75%), Positives = 56/65 (86%) Frame = +3 Query: 51 NPRPLSAAVSRALIHYASNSNNSDHMSYTDMKQISDALRQCSPPCNLLVFGLTAESLLWR 230 NP PLS AV RAL HYASNSNN++ MSYTD+KQI+D LRQC PCNLLVFGLT E+LLW+ Sbjct: 67 NP-PLSKAVVRALTHYASNSNNTERMSYTDIKQIADVLRQCQQPCNLLVFGLTHETLLWK 125 Query: 231 ALNHH 245 ALNH+ Sbjct: 126 ALNHN 130 >gb|EPS63094.1| hypothetical protein M569_11690, partial [Genlisea aurea] Length = 307 Score = 102 bits (255), Expect = 4e-20 Identities = 47/63 (74%), Positives = 57/63 (90%) Frame = +3 Query: 54 PRPLSAAVSRALIHYASNSNNSDHMSYTDMKQISDALRQCSPPCNLLVFGLTAESLLWRA 233 P PLS+AV+RALIHYASNSN++D MS TD++QI+DAL+QCS PCN LVFGLT E+LLW+A Sbjct: 65 PPPLSSAVARALIHYASNSNSTDRMSLTDIRQIADALQQCSRPCNFLVFGLTHETLLWKA 124 Query: 234 LNH 242 LNH Sbjct: 125 LNH 127 >ref|XP_004233444.1| PREDICTED: protein IRX15-like [Solanum lycopersicum] Length = 300 Score = 102 bits (255), Expect = 4e-20 Identities = 49/65 (75%), Positives = 56/65 (86%) Frame = +3 Query: 51 NPRPLSAAVSRALIHYASNSNNSDHMSYTDMKQISDALRQCSPPCNLLVFGLTAESLLWR 230 NP PLS AV RAL HYASNSNN++ MSYTD+KQI+D LRQC PCNLLVFGLT E+LLW+ Sbjct: 67 NP-PLSKAVVRALTHYASNSNNTERMSYTDIKQIADVLRQCQQPCNLLVFGLTHETLLWK 125 Query: 231 ALNHH 245 ALNH+ Sbjct: 126 ALNHN 130 >ref|XP_002866713.1| nucleic acid binding protein [Arabidopsis lyrata subsp. lyrata] gi|297312548|gb|EFH42972.1| nucleic acid binding protein [Arabidopsis lyrata subsp. lyrata] Length = 316 Score = 91.7 bits (226), Expect = 1e-16 Identities = 41/61 (67%), Positives = 50/61 (81%) Frame = +3 Query: 63 LSAAVSRALIHYASNSNNSDHMSYTDMKQISDALRQCSPPCNLLVFGLTAESLLWRALNH 242 L A A++HYAS SN+S HMSY +MK ISD LR+CSPPCNLLVFGLT E+LLW++LNH Sbjct: 77 LPTAAINAMLHYASRSNDSFHMSYGEMKSISDVLRRCSPPCNLLVFGLTHETLLWKSLNH 136 Query: 243 H 245 + Sbjct: 137 N 137 >ref|XP_006404049.1| hypothetical protein EUTSA_v10010543mg [Eutrema salsugineum] gi|557105168|gb|ESQ45502.1| hypothetical protein EUTSA_v10010543mg [Eutrema salsugineum] Length = 325 Score = 90.9 bits (224), Expect = 2e-16 Identities = 41/65 (63%), Positives = 50/65 (76%) Frame = +3 Query: 51 NPRPLSAAVSRALIHYASNSNNSDHMSYTDMKQISDALRQCSPPCNLLVFGLTAESLLWR 230 N L AL+HYAS SN+S HMSY +MK ISD LR+C+PPCNLLVFGLT E+LLW+ Sbjct: 82 NSNNLPTTAINALLHYASRSNDSFHMSYGEMKSISDVLRRCAPPCNLLVFGLTHETLLWK 141 Query: 231 ALNHH 245 +LNH+ Sbjct: 142 SLNHN 146 >ref|XP_004509113.1| PREDICTED: protein IRX15-like [Cicer arietinum] Length = 306 Score = 90.9 bits (224), Expect = 2e-16 Identities = 39/62 (62%), Positives = 51/62 (82%) Frame = +3 Query: 60 PLSAAVSRALIHYASNSNNSDHMSYTDMKQISDALRQCSPPCNLLVFGLTAESLLWRALN 239 PL + V L+HYAS SN++ HM+Y+D+K ISD LR+CS PCNLL+FGLT E+LLW+ALN Sbjct: 71 PLPSTVINTLLHYASKSNDTYHMTYSDLKPISDVLRKCSSPCNLLIFGLTPETLLWKALN 130 Query: 240 HH 245 H+ Sbjct: 131 HN 132 >ref|XP_007155898.1| hypothetical protein PHAVU_003G241300g [Phaseolus vulgaris] gi|561029252|gb|ESW27892.1| hypothetical protein PHAVU_003G241300g [Phaseolus vulgaris] Length = 315 Score = 90.1 bits (222), Expect = 3e-16 Identities = 38/62 (61%), Positives = 51/62 (82%) Frame = +3 Query: 60 PLSAAVSRALIHYASNSNNSDHMSYTDMKQISDALRQCSPPCNLLVFGLTAESLLWRALN 239 PL V L+HYAS SN+++HM ++D+K ISD LR+CS PCNLL+FGLT+E+LLW+ALN Sbjct: 74 PLPPTVINTLLHYASKSNDTNHMPHSDLKPISDVLRKCSSPCNLLIFGLTSETLLWKALN 133 Query: 240 HH 245 H+ Sbjct: 134 HY 135 >ref|XP_006393919.1| hypothetical protein EUTSA_v10004623mg [Eutrema salsugineum] gi|557090558|gb|ESQ31205.1| hypothetical protein EUTSA_v10004623mg [Eutrema salsugineum] Length = 316 Score = 90.1 bits (222), Expect = 3e-16 Identities = 40/61 (65%), Positives = 50/61 (81%) Frame = +3 Query: 63 LSAAVSRALIHYASNSNNSDHMSYTDMKQISDALRQCSPPCNLLVFGLTAESLLWRALNH 242 L + AL+HYAS SN+S HMSY +MK ISD LR+C+PPCNLLVFGLT E+LLW++LNH Sbjct: 77 LPTSAINALLHYASRSNDSFHMSYGEMKSISDVLRRCAPPCNLLVFGLTHETLLWKSLNH 136 Query: 243 H 245 + Sbjct: 137 N 137 >ref|XP_006280826.1| hypothetical protein CARUB_v10026796mg [Capsella rubella] gi|482549530|gb|EOA13724.1| hypothetical protein CARUB_v10026796mg [Capsella rubella] Length = 318 Score = 90.1 bits (222), Expect = 3e-16 Identities = 40/61 (65%), Positives = 49/61 (80%) Frame = +3 Query: 63 LSAAVSRALIHYASNSNNSDHMSYTDMKQISDALRQCSPPCNLLVFGLTAESLLWRALNH 242 L A++HYAS SN+S HMSY +MK ISD LR+CSPPCNLLVFGLT E+LLW++LNH Sbjct: 79 LPTTAINAMLHYASRSNDSFHMSYGEMKSISDVLRRCSPPCNLLVFGLTHETLLWKSLNH 138 Query: 243 H 245 + Sbjct: 139 N 139 >ref|NP_201522.1| uncharacterized protein [Arabidopsis thaliana] gi|75170575|sp|Q9FH92.1|IX15L_ARATH RecName: Full=Protein IRX15-LIKE gi|10177608|dbj|BAB10955.1| unnamed protein product [Arabidopsis thaliana] gi|27765046|gb|AAO23644.1| At5g67210 [Arabidopsis thaliana] gi|110743406|dbj|BAE99589.1| hypothetical protein [Arabidopsis thaliana] gi|332010931|gb|AED98314.1| uncharacterized protein AT5G67210 [Arabidopsis thaliana] Length = 317 Score = 90.1 bits (222), Expect = 3e-16 Identities = 40/61 (65%), Positives = 49/61 (80%) Frame = +3 Query: 63 LSAAVSRALIHYASNSNNSDHMSYTDMKQISDALRQCSPPCNLLVFGLTAESLLWRALNH 242 L A++HYAS SN+S HMSY +MK ISD LR+CSPPCNLLVFGLT E+LLW++LNH Sbjct: 77 LPTTAINAMLHYASRSNDSYHMSYGEMKSISDVLRRCSPPCNLLVFGLTHETLLWKSLNH 136 Query: 243 H 245 + Sbjct: 137 N 137 >ref|XP_002877736.1| hypothetical protein ARALYDRAFT_906343 [Arabidopsis lyrata subsp. lyrata] gi|297323574|gb|EFH53995.1| hypothetical protein ARALYDRAFT_906343 [Arabidopsis lyrata subsp. lyrata] Length = 322 Score = 90.1 bits (222), Expect = 3e-16 Identities = 40/61 (65%), Positives = 50/61 (81%) Frame = +3 Query: 63 LSAAVSRALIHYASNSNNSDHMSYTDMKQISDALRQCSPPCNLLVFGLTAESLLWRALNH 242 L + AL+HYAS SN+S HMSY +MK ISD LR+C+PPCNLLVFGLT E+LLW++LNH Sbjct: 84 LPTSAINALLHYASRSNDSFHMSYGEMKSISDVLRRCAPPCNLLVFGLTHETLLWKSLNH 143 Query: 243 H 245 + Sbjct: 144 N 144 >gb|ABK28594.1| unknown [Arabidopsis thaliana] Length = 323 Score = 90.1 bits (222), Expect = 3e-16 Identities = 40/61 (65%), Positives = 50/61 (81%) Frame = +3 Query: 63 LSAAVSRALIHYASNSNNSDHMSYTDMKQISDALRQCSPPCNLLVFGLTAESLLWRALNH 242 L + AL+HYAS SN+S HMSY +MK ISD LR+C+PPCNLLVFGLT E+LLW++LNH Sbjct: 84 LPTSAINALLHYASRSNDSFHMSYGEMKSISDVLRRCAPPCNLLVFGLTHETLLWKSLNH 143 Query: 243 H 245 + Sbjct: 144 N 144 >dbj|BAD94344.1| hypothetical protein [Arabidopsis thaliana] Length = 322 Score = 90.1 bits (222), Expect = 3e-16 Identities = 40/61 (65%), Positives = 50/61 (81%) Frame = +3 Query: 63 LSAAVSRALIHYASNSNNSDHMSYTDMKQISDALRQCSPPCNLLVFGLTAESLLWRALNH 242 L + AL+HYAS SN+S HMSY +MK ISD LR+C+PPCNLLVFGLT E+LLW++LNH Sbjct: 84 LPTSAINALLHYASRSNDSFHMSYGEMKSISDVLRRCAPPCNLLVFGLTHETLLWKSLNH 143 Query: 243 H 245 + Sbjct: 144 N 144 >gb|AAM64983.1| unknown [Arabidopsis thaliana] Length = 322 Score = 90.1 bits (222), Expect = 3e-16 Identities = 40/61 (65%), Positives = 50/61 (81%) Frame = +3 Query: 63 LSAAVSRALIHYASNSNNSDHMSYTDMKQISDALRQCSPPCNLLVFGLTAESLLWRALNH 242 L + AL+HYAS SN+S HMSY +MK ISD LR+C+PPCNLLVFGLT E+LLW++LNH Sbjct: 84 LPTSAINALLHYASRSNDSFHMSYGEMKSISDVLRRCAPPCNLLVFGLTHETLLWKSLNH 143 Query: 243 H 245 + Sbjct: 144 N 144 >ref|NP_190591.1| protein IRREGULAR XYLEM 15 [Arabidopsis thaliana] gi|75206920|sp|Q9SNE5.1|IRX15_ARATH RecName: Full=Protein IRREGULAR XYLEM 15; Short=AtIRX15 gi|6523033|emb|CAB62301.1| putative protein [Arabidopsis thaliana] gi|91806556|gb|ABE66005.1| unknown [Arabidopsis thaliana] gi|332645121|gb|AEE78642.1| uncharacterized protein AT3G50220 [Arabidopsis thaliana] Length = 322 Score = 90.1 bits (222), Expect = 3e-16 Identities = 40/61 (65%), Positives = 50/61 (81%) Frame = +3 Query: 63 LSAAVSRALIHYASNSNNSDHMSYTDMKQISDALRQCSPPCNLLVFGLTAESLLWRALNH 242 L + AL+HYAS SN+S HMSY +MK ISD LR+C+PPCNLLVFGLT E+LLW++LNH Sbjct: 84 LPTSAINALLHYASRSNDSFHMSYGEMKSISDVLRRCAPPCNLLVFGLTHETLLWKSLNH 143 Query: 243 H 245 + Sbjct: 144 N 144 >ref|XP_002533263.1| conserved hypothetical protein [Ricinus communis] gi|223526919|gb|EEF29125.1| conserved hypothetical protein [Ricinus communis] Length = 328 Score = 89.7 bits (221), Expect = 4e-16 Identities = 41/61 (67%), Positives = 50/61 (81%) Frame = +3 Query: 63 LSAAVSRALIHYASNSNNSDHMSYTDMKQISDALRQCSPPCNLLVFGLTAESLLWRALNH 242 L AV L+HYAS SN+S HMSY+++K ISD LR+CS PCNLLVFGLT E+LLW+ALNH Sbjct: 78 LPTAVINTLLHYASRSNDSFHMSYSEIKPISDVLRKCSSPCNLLVFGLTHETLLWKALNH 137 Query: 243 H 245 + Sbjct: 138 N 138 >gb|AFK46333.1| unknown [Lotus japonicus] Length = 208 Score = 89.4 bits (220), Expect = 5e-16 Identities = 39/62 (62%), Positives = 50/62 (80%) Frame = +3 Query: 60 PLSAAVSRALIHYASNSNNSDHMSYTDMKQISDALRQCSPPCNLLVFGLTAESLLWRALN 239 PL A V L+HYA+ SN++ HM Y+D+K ISD LR+CS PCNLL+FGLT E+LLW+ALN Sbjct: 73 PLPATVINTLLHYAAKSNDTFHMPYSDLKPISDMLRKCSSPCNLLIFGLTHETLLWKALN 132 Query: 240 HH 245 H+ Sbjct: 133 HN 134 >ref|XP_002283187.1| PREDICTED: uncharacterized protein LOC100259508 [Vitis vinifera] Length = 310 Score = 88.6 bits (218), Expect = 8e-16 Identities = 40/61 (65%), Positives = 48/61 (78%) Frame = +3 Query: 63 LSAAVSRALIHYASNSNNSDHMSYTDMKQISDALRQCSPPCNLLVFGLTAESLLWRALNH 242 L+ V AL+HYASN N S HMS ++K ISD LR+CSPPCN LVFGLT E+LLW+ALNH Sbjct: 69 LAKPVVDALVHYASNYNTSGHMSNAELKMISDVLRKCSPPCNFLVFGLTLETLLWKALNH 128 Query: 243 H 245 + Sbjct: 129 N 129