BLASTX nr result
ID: Mentha29_contig00040684
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00040684 (297 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU39181.1| hypothetical protein MIMGU_mgv1a002241mg [Mimulus... 76 6e-12 >gb|EYU39181.1| hypothetical protein MIMGU_mgv1a002241mg [Mimulus guttatus] Length = 696 Score = 75.9 bits (185), Expect = 6e-12 Identities = 35/48 (72%), Positives = 40/48 (83%), Gaps = 5/48 (10%) Frame = +1 Query: 97 MSRPPNYEFQEWWNKQRAKDTADDH-----LTSSSTAEDFRVLTVDIH 225 MSRPPNYEFQEWWNKQR+KD ADDH +SSS +EDFR+LTV+IH Sbjct: 1 MSRPPNYEFQEWWNKQRSKDPADDHHHHHLSSSSSASEDFRLLTVNIH 48