BLASTX nr result
ID: Mentha29_contig00040680
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00040680 (272 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006352873.1| PREDICTED: uncharacterized protein LOC102603... 60 3e-07 ref|XP_004245908.1| PREDICTED: uncharacterized protein LOC101247... 58 2e-06 ref|XP_002527653.1| conserved hypothetical protein [Ricinus comm... 57 3e-06 >ref|XP_006352873.1| PREDICTED: uncharacterized protein LOC102603188 [Solanum tuberosum] Length = 302 Score = 60.1 bits (144), Expect = 3e-07 Identities = 26/38 (68%), Positives = 31/38 (81%) Frame = -2 Query: 121 DAEPNYIGGYYLDMIKSDPTNSLLLRNYGKYLHEVEGD 8 +++P IG YY +M+ SDP NSLLLRNYGKYLHEVE D Sbjct: 173 NSDPRKIGAYYKEMLNSDPMNSLLLRNYGKYLHEVERD 210 >ref|XP_004245908.1| PREDICTED: uncharacterized protein LOC101247449 [Solanum lycopersicum] Length = 302 Score = 57.8 bits (138), Expect = 2e-06 Identities = 25/37 (67%), Positives = 29/37 (78%) Frame = -2 Query: 118 AEPNYIGGYYLDMIKSDPTNSLLLRNYGKYLHEVEGD 8 ++P IG YY +M+ SDP N LLLRNYGKYLHEVE D Sbjct: 174 SDPRKIGAYYKEMLNSDPMNPLLLRNYGKYLHEVERD 210 >ref|XP_002527653.1| conserved hypothetical protein [Ricinus communis] gi|223532958|gb|EEF34724.1| conserved hypothetical protein [Ricinus communis] Length = 268 Score = 57.0 bits (136), Expect = 3e-06 Identities = 24/33 (72%), Positives = 30/33 (90%) Frame = -2 Query: 103 IGGYYLDMIKSDPTNSLLLRNYGKYLHEVEGDV 5 IG YY +M+KS+P +SLLLRNYGK+LHEVEGD+ Sbjct: 148 IGDYYTEMLKSNPNDSLLLRNYGKFLHEVEGDM 180