BLASTX nr result
ID: Mentha29_contig00040478
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00040478 (213 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU44864.1| hypothetical protein MIMGU_mgv1a011922mg [Mimulus... 57 2e-06 >gb|EYU44864.1| hypothetical protein MIMGU_mgv1a011922mg [Mimulus guttatus] Length = 266 Score = 57.4 bits (137), Expect = 2e-06 Identities = 35/67 (52%), Positives = 45/67 (67%), Gaps = 4/67 (5%) Frame = -3 Query: 193 SAVRLSNSRILSLPSLEMPRGIGLSLEDRLEPMVLDEAEQEQLYDRPS----TSKVQWPI 26 S V LS++R S+PS E+ G G SLEDRLEPMVL+E E+EQ RPS +S + PI Sbjct: 5 SVVSLSSNRSHSVPSAEIFCGTGFSLEDRLEPMVLNEDEEEQPNARPSKENISSNMHGPI 64 Query: 25 RVVELNS 5 + VE +S Sbjct: 65 QDVEFDS 71