BLASTX nr result
ID: Mentha29_contig00040291
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00040291 (271 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU21791.1| hypothetical protein MIMGU_mgv1a001064mg [Mimulus... 55 8e-06 >gb|EYU21791.1| hypothetical protein MIMGU_mgv1a001064mg [Mimulus guttatus] Length = 898 Score = 55.5 bits (132), Expect = 8e-06 Identities = 28/54 (51%), Positives = 39/54 (72%) Frame = +1 Query: 19 QWAVEESSVFPRLEQLRLFDLKELEAIPLEIENVPTLQRIWMIGCGESAVMSAK 180 +W +S+ FPRLEQL+L+DL +L+ IP I +PTL I +I C +SAV+SAK Sbjct: 818 EWWTTDSTHFPRLEQLKLWDLYKLKEIPSCIGEIPTLGSIELIYCSKSAVISAK 871