BLASTX nr result
ID: Mentha29_contig00040102
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00040102 (352 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS66200.1| hypothetical protein M569_08577 [Genlisea aurea] 66 4e-09 gb|EYU29059.1| hypothetical protein MIMGU_mgv1a005079mg [Mimulus... 60 2e-07 gb|EYU29058.1| hypothetical protein MIMGU_mgv1a005079mg [Mimulus... 60 2e-07 >gb|EPS66200.1| hypothetical protein M569_08577 [Genlisea aurea] Length = 513 Score = 66.2 bits (160), Expect = 4e-09 Identities = 28/36 (77%), Positives = 32/36 (88%) Frame = -2 Query: 108 MGYENDPYRDEDGEPLMDFDEDIPSDGDEPQQYLLD 1 M YENDPYRDEDGEPLMDFDE+ PSD +E QQ++LD Sbjct: 1 MAYENDPYRDEDGEPLMDFDEEYPSDREERQQHILD 36 >gb|EYU29059.1| hypothetical protein MIMGU_mgv1a005079mg [Mimulus guttatus] Length = 497 Score = 60.5 bits (145), Expect = 2e-07 Identities = 26/29 (89%), Positives = 27/29 (93%) Frame = -2 Query: 108 MGYENDPYRDEDGEPLMDFDEDIPSDGDE 22 MGYENDPYRDEDGEPLMDFDEDI S+ DE Sbjct: 1 MGYENDPYRDEDGEPLMDFDEDIQSEHDE 29 >gb|EYU29058.1| hypothetical protein MIMGU_mgv1a005079mg [Mimulus guttatus] Length = 397 Score = 60.5 bits (145), Expect = 2e-07 Identities = 26/29 (89%), Positives = 27/29 (93%) Frame = -2 Query: 108 MGYENDPYRDEDGEPLMDFDEDIPSDGDE 22 MGYENDPYRDEDGEPLMDFDEDI S+ DE Sbjct: 1 MGYENDPYRDEDGEPLMDFDEDIQSEHDE 29