BLASTX nr result
ID: Mentha29_contig00040092
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00040092 (239 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU35675.1| hypothetical protein MIMGU_mgv1a007801mg [Mimulus... 70 2e-10 >gb|EYU35675.1| hypothetical protein MIMGU_mgv1a007801mg [Mimulus guttatus] Length = 395 Score = 70.5 bits (171), Expect = 2e-10 Identities = 30/45 (66%), Positives = 38/45 (84%) Frame = -3 Query: 237 YGKDGKPIPGILQNLDYNGIEESLKKGKGGKVNMDPYFLASDSEK 103 +GKDGK +P ILQNLDY+GI+ESLKK KGGK++ DPYF SD ++ Sbjct: 347 HGKDGKAVPNILQNLDYSGIDESLKKDKGGKISSDPYFFHSDDKE 391