BLASTX nr result
ID: Mentha29_contig00040012
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00040012 (377 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU42169.1| hypothetical protein MIMGU_mgv1a018451mg [Mimulus... 52 1e-09 gb|EYU39516.1| hypothetical protein MIMGU_mgv1a023055mg [Mimulus... 47 1e-08 >gb|EYU42169.1| hypothetical protein MIMGU_mgv1a018451mg [Mimulus guttatus] Length = 870 Score = 52.0 bits (123), Expect(2) = 1e-09 Identities = 26/49 (53%), Positives = 32/49 (65%) Frame = +2 Query: 113 EDDDDVVGLEKDVEQLLLRSVFNKQEGFSFSIVSGMAGIGKTALARQVY 259 + D DVVGLE DVE +L VF K++G + GM GIGK+ LAR VY Sbjct: 160 QKDKDVVGLEADVESVLHNIVFTKRKGLVIGSIVGMGGIGKSTLARIVY 208 Score = 36.2 bits (82), Expect(2) = 1e-09 Identities = 17/36 (47%), Positives = 26/36 (72%) Frame = +3 Query: 267 SVVERFERRRAWVCFSPHLSCREILMKLIQQLVVPA 374 +VV +FERR AWVC S S +EI+ +++ QL+ P+ Sbjct: 212 TVVNQFERR-AWVCISSEFSPKEIIKEVVLQLLEPS 246 >gb|EYU39516.1| hypothetical protein MIMGU_mgv1a023055mg [Mimulus guttatus] Length = 918 Score = 47.4 bits (111), Expect(2) = 1e-08 Identities = 24/49 (48%), Positives = 31/49 (63%) Frame = +2 Query: 113 EDDDDVVGLEKDVEQLLLRSVFNKQEGFSFSIVSGMAGIGKTALARQVY 259 + D VVGLE DVE +L + V K++G + GM GIGK+ LAR VY Sbjct: 160 QKDKHVVGLEADVESVLDKIVLTKRKGLIIGSIVGMGGIGKSTLARIVY 208 Score = 37.4 bits (85), Expect(2) = 1e-08 Identities = 18/35 (51%), Positives = 25/35 (71%) Frame = +3 Query: 267 SVVERFERRRAWVCFSPHLSCREILMKLIQQLVVP 371 +VV RFERR AWVC S S +EI+ +++ QL+ P Sbjct: 212 TVVNRFERR-AWVCISSEFSPKEIMKEVVLQLLEP 245