BLASTX nr result
ID: Mentha29_contig00039239
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00039239 (222 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004305927.1| PREDICTED: F-box protein At5g07610-like [Fra... 56 4e-06 ref|XP_007029914.1| F-box family protein, putative [Theobroma ca... 56 6e-06 ref|XP_002520646.1| conserved hypothetical protein [Ricinus comm... 55 1e-05 >ref|XP_004305927.1| PREDICTED: F-box protein At5g07610-like [Fragaria vesca subsp. vesca] Length = 397 Score = 56.2 bits (134), Expect = 4e-06 Identities = 27/36 (75%), Positives = 30/36 (83%) Frame = +3 Query: 3 EDLLIEILLFLPAKPLVKFKIVSKKWNSLISSPFFC 110 E+LL EILL LPAKPLV+FK VSK W SLIS+P FC Sbjct: 22 EELLTEILLLLPAKPLVRFKCVSKHWLSLISNPNFC 57 >ref|XP_007029914.1| F-box family protein, putative [Theobroma cacao] gi|508718519|gb|EOY10416.1| F-box family protein, putative [Theobroma cacao] Length = 393 Score = 55.8 bits (133), Expect = 6e-06 Identities = 28/36 (77%), Positives = 30/36 (83%) Frame = +3 Query: 3 EDLLIEILLFLPAKPLVKFKIVSKKWNSLISSPFFC 110 EDLL EILL LPAKPL+KFK VSK+W SLISS FC Sbjct: 16 EDLLTEILLRLPAKPLLKFKFVSKEWFSLISSSQFC 51 >ref|XP_002520646.1| conserved hypothetical protein [Ricinus communis] gi|223540166|gb|EEF41742.1| conserved hypothetical protein [Ricinus communis] Length = 397 Score = 55.1 bits (131), Expect = 1e-05 Identities = 27/35 (77%), Positives = 30/35 (85%) Frame = +3 Query: 3 EDLLIEILLFLPAKPLVKFKIVSKKWNSLISSPFF 107 EDLLIEILL LP K L+KFK VSK+WNSLISS +F Sbjct: 20 EDLLIEILLRLPVKTLLKFKCVSKQWNSLISSSYF 54