BLASTX nr result
ID: Mentha29_contig00039123
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00039123 (336 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU27961.1| hypothetical protein MIMGU_mgv1a015869mg [Mimulus... 55 8e-06 >gb|EYU27961.1| hypothetical protein MIMGU_mgv1a015869mg [Mimulus guttatus] Length = 142 Score = 55.5 bits (132), Expect = 8e-06 Identities = 23/38 (60%), Positives = 31/38 (81%) Frame = +2 Query: 221 SHISRNFSSFHHVQECFRACVSGCGYKFEVPSEKVSQV 334 ++I R+ S + +ECFRAC+SGCGYKF++P EKVSQV Sbjct: 65 AYIDRSPGSAAYSEECFRACISGCGYKFDIPLEKVSQV 102