BLASTX nr result
ID: Mentha29_contig00039022
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00039022 (274 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU19293.1| hypothetical protein MIMGU_mgv1a017958mg [Mimulus... 67 3e-09 >gb|EYU19293.1| hypothetical protein MIMGU_mgv1a017958mg [Mimulus guttatus] Length = 383 Score = 66.6 bits (161), Expect = 3e-09 Identities = 35/62 (56%), Positives = 50/62 (80%), Gaps = 2/62 (3%) Frame = -2 Query: 273 NVIIQGLLKRNDVFQAMLSFMEEMCKREFSADAAALSMILDQVRG--QDDVLCEMIKKVV 100 N I+QGLLK+ +V++A + F+EEM +R FSADAA SM++ +++G +DDVL E+IKKVV Sbjct: 322 NYIVQGLLKKKEVYKA-IPFLEEMHERGFSADAATSSMLISRLQGSNKDDVLLELIKKVV 380 Query: 99 PK 94 PK Sbjct: 381 PK 382