BLASTX nr result
ID: Mentha29_contig00039003
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00039003 (385 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU24059.1| hypothetical protein MIMGU_mgv1a026856mg, partial... 66 4e-09 >gb|EYU24059.1| hypothetical protein MIMGU_mgv1a026856mg, partial [Mimulus guttatus] Length = 471 Score = 66.2 bits (160), Expect = 4e-09 Identities = 34/65 (52%), Positives = 45/65 (69%) Frame = -2 Query: 195 MKSYRQKTRKRGCISIDQDECIGVNLKKPANGTGQAPRSSLEIIRMPHTDPPVQLQIPST 16 MK Y+Q+ RKR I+ QDEC GV++KK ANGTG + +I H +P +Q+Q+PST Sbjct: 1 MKCYKQQKRKRVEITRKQDECTGVSVKKSANGTGWERQ---KITESTHLEPQIQIQVPST 57 Query: 15 KIKLQ 1 KIKLQ Sbjct: 58 KIKLQ 62