BLASTX nr result
ID: Mentha29_contig00038998
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00038998 (206 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU22956.1| hypothetical protein MIMGU_mgv1a001023mg [Mimulus... 85 9e-15 >gb|EYU22956.1| hypothetical protein MIMGU_mgv1a001023mg [Mimulus guttatus] Length = 909 Score = 85.1 bits (209), Expect = 9e-15 Identities = 46/59 (77%), Positives = 49/59 (83%) Frame = -2 Query: 178 GEVEDGLIDLNKEPPAERKRKRGEKSSLDHKGNEGGDGLPKSGRVLRSRTVAMSDGEKQ 2 GEVEDGLIDLNKEP ERKRKR E+ S KGNE + LPK+GRVLRSRTVAMSDGEKQ Sbjct: 6 GEVEDGLIDLNKEP-VERKRKRVEEISSAGKGNERSNDLPKTGRVLRSRTVAMSDGEKQ 63