BLASTX nr result
ID: Mentha29_contig00038981
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00038981 (239 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006350883.1| PREDICTED: B3 domain-containing protein Os07... 59 7e-07 ref|XP_004242480.1| PREDICTED: B3 domain-containing protein Os07... 59 7e-07 gb|EYU36907.1| hypothetical protein MIMGU_mgv1a001615mg [Mimulus... 57 3e-06 >ref|XP_006350883.1| PREDICTED: B3 domain-containing protein Os07g0679700-like isoform X1 [Solanum tuberosum] gi|565368503|ref|XP_006350884.1| PREDICTED: B3 domain-containing protein Os07g0679700-like isoform X2 [Solanum tuberosum] gi|565368505|ref|XP_006350885.1| PREDICTED: B3 domain-containing protein Os07g0679700-like isoform X3 [Solanum tuberosum] Length = 845 Score = 58.9 bits (141), Expect = 7e-07 Identities = 31/61 (50%), Positives = 43/61 (70%), Gaps = 1/61 (1%) Frame = -3 Query: 237 KGKLDLNCDPHREDDILAR-TGGMSLTTLMNAVYLPLDLYSRESGPPPPRSLLSQTAVEN 61 KG+LDLNC P+R+DD+LA T GMS+T+L+NA LPL+ ++ SLLSQ A E+ Sbjct: 762 KGQLDLNCHPNRDDDMLAEATAGMSMTSLVNATNLPLEYLTQNRLESLGNSLLSQAASES 821 Query: 60 Q 58 + Sbjct: 822 E 822 >ref|XP_004242480.1| PREDICTED: B3 domain-containing protein Os07g0679700-like [Solanum lycopersicum] Length = 845 Score = 58.9 bits (141), Expect = 7e-07 Identities = 31/61 (50%), Positives = 43/61 (70%), Gaps = 1/61 (1%) Frame = -3 Query: 237 KGKLDLNCDPHREDDILAR-TGGMSLTTLMNAVYLPLDLYSRESGPPPPRSLLSQTAVEN 61 KG+LDLNC P+R+DD+LA T GMS+T+L+NA LPL+ ++ SLLSQ A E+ Sbjct: 762 KGQLDLNCHPNRDDDMLAEATAGMSMTSLVNATNLPLEYLTQNRLESLGNSLLSQAASES 821 Query: 60 Q 58 + Sbjct: 822 E 822 >gb|EYU36907.1| hypothetical protein MIMGU_mgv1a001615mg [Mimulus guttatus] Length = 785 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/35 (71%), Positives = 27/35 (77%) Frame = -3 Query: 231 KLDLNCDPHREDDILARTGGMSLTTLMNAVYLPLD 127 KLDLNCDPHRED++L GMSLT LMNA PLD Sbjct: 723 KLDLNCDPHREDEVLLEASGMSLTALMNAASCPLD 757