BLASTX nr result
ID: Mentha29_contig00038741
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00038741 (403 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU23464.1| hypothetical protein MIMGU_mgv1a005322mg [Mimulus... 57 3e-06 >gb|EYU23464.1| hypothetical protein MIMGU_mgv1a005322mg [Mimulus guttatus] Length = 489 Score = 57.0 bits (136), Expect = 3e-06 Identities = 36/102 (35%), Positives = 52/102 (50%), Gaps = 2/102 (1%) Frame = +3 Query: 102 AGQMVMREDYYHVFMPSNTFAFALSAVIIIFVVPGSPXXXXXXXXXXXXXXXXXXALGAI 281 AG+MVM ++ Y +F+P+ T AF LS V+IIFV+ G P A+ + Sbjct: 344 AGKMVMTKEDYELFVPAATAAFTLSVVMIIFVLHGRPYNLILHGSLIFLAYSYLAAMRFM 403 Query: 282 S--YYTGFSKVIFLLSMYAIVGAYFVKLFYYPVKALLIEKDW 401 S +K F+LS IV A+ +K+ YY KAL + W Sbjct: 404 SPEEDRAVAKFTFILSWTVIVAAFALKIMYYFAKALFEDSWW 445