BLASTX nr result
ID: Mentha29_contig00038668
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00038668 (491 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU20856.1| hypothetical protein MIMGU_mgv1a005872mg [Mimulus... 56 6e-06 >gb|EYU20856.1| hypothetical protein MIMGU_mgv1a005872mg [Mimulus guttatus] Length = 466 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/49 (53%), Positives = 35/49 (71%), Gaps = 1/49 (2%) Frame = -3 Query: 351 MAENGAPLIEKLE-YHANCAACKIERKKESNDGIPFKLLIMVWVVSLAA 208 M + PLI+K YH +C AC IE+ KES++GIPFKL VW+++LAA Sbjct: 1 MEDKSEPLIKKRGGYHESCEACTIEKFKESSNGIPFKLFSFVWIITLAA 49