BLASTX nr result
ID: Mentha29_contig00038478
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00038478 (436 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU43123.1| hypothetical protein MIMGU_mgv1a011058mg [Mimulus... 55 8e-06 >gb|EYU43123.1| hypothetical protein MIMGU_mgv1a011058mg [Mimulus guttatus] Length = 293 Score = 55.5 bits (132), Expect = 8e-06 Identities = 31/65 (47%), Positives = 42/65 (64%) Frame = +2 Query: 242 MGSLWESLLSPLKNLVTPRHLRRYGNVLSNYLKNTNSEKLGLSQVQVETKSLKNFKEVER 421 MGS W S SP R LRRYG +LS+YLK + + L Q++ ETKSL++ EVE+ Sbjct: 1 MGSWWGSFFSPANTY--RRRLRRYGYILSSYLKGNENVDVVL-QMEAETKSLQSLGEVEK 57 Query: 422 IIGYS 436 +IGY+ Sbjct: 58 MIGYN 62