BLASTX nr result
ID: Mentha29_contig00038049
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00038049 (437 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU41195.1| hypothetical protein MIMGU_mgv1a014259mg [Mimulus... 91 2e-16 gb|EPS65494.1| hypothetical protein M569_09287 [Genlisea aurea] 66 4e-09 >gb|EYU41195.1| hypothetical protein MIMGU_mgv1a014259mg [Mimulus guttatus] Length = 195 Score = 90.5 bits (223), Expect = 2e-16 Identities = 48/106 (45%), Positives = 67/106 (63%), Gaps = 2/106 (1%) Frame = -2 Query: 313 MDSLN-GNVKNTLLERCKSPVDVNGGIVSPNKRKDAGEEMPRCD-SLQLVTYPKACNSTQ 140 MDSL+ VK +R K+ V+ + N AGE+ RCD SLQ+ T P ACN Q Sbjct: 1 MDSLDPAKVKKITWKRSKTQVE------NANHEAAAGEKRARCDDSLQVSTPPIACNLAQ 54 Query: 139 SFALALMPVPKVEKWCSNTSIVLTGTACRGGSGPPIGITDIGESKS 2 S+ + ++P+PK+++WC SI GTACRG +GPP+G+ DIG SK+ Sbjct: 55 SYVMPMLPMPKMDEWCLKKSICFGGTACRGVTGPPVGVVDIGVSKN 100 >gb|EPS65494.1| hypothetical protein M569_09287 [Genlisea aurea] Length = 181 Score = 66.2 bits (160), Expect = 4e-09 Identities = 29/46 (63%), Positives = 36/46 (78%) Frame = -2 Query: 139 SFALALMPVPKVEKWCSNTSIVLTGTACRGGSGPPIGITDIGESKS 2 S+AL L+ +PKVE+WCS + I TGTA R G+GPPIG+ DIG SKS Sbjct: 42 SYALPLLSIPKVEEWCSGSGIAFTGTASRVGTGPPIGVLDIGVSKS 87