BLASTX nr result
ID: Mentha29_contig00037477
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00037477 (395 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007202494.1| hypothetical protein PRUPE_ppa010620mg [Prun... 62 6e-08 >ref|XP_007202494.1| hypothetical protein PRUPE_ppa010620mg [Prunus persica] gi|462398025|gb|EMJ03693.1| hypothetical protein PRUPE_ppa010620mg [Prunus persica] Length = 214 Score = 62.4 bits (150), Expect = 6e-08 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = -3 Query: 393 GHLYYFLTVLHPLAGGKNILKTPAFLYPYF 304 GHLYYFLTVLHPLAGGKNIL+TP ++YPYF Sbjct: 179 GHLYYFLTVLHPLAGGKNILQTPRWVYPYF 208