BLASTX nr result
ID: Mentha29_contig00037000
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00037000 (366 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002531889.1| Stearoy-ACP desaturase [Ricinus communis] gi... 60 3e-07 dbj|BAA07681.1| stearoyl-acyl carrier protein desaturase [Sesamu... 60 3e-07 dbj|BAA08635.1| stearoyl-acyl carrier protein desaturase [Sesamu... 60 3e-07 pdb|1AFR|A Chain A, Stearoyl-Acyl Carrier Protein Desaturase Fro... 60 3e-07 ref|XP_006494043.1| PREDICTED: acyl-[acyl-carrier-protein] desat... 60 3e-07 ref|XP_006442769.1| hypothetical protein CICLE_v10020487mg [Citr... 60 3e-07 ref|XP_006376444.1| hypothetical protein POPTR_0013s13100g [Popu... 60 3e-07 ref|XP_006828767.1| hypothetical protein AMTR_s00001p00087250 [A... 60 3e-07 ref|XP_006828766.1| hypothetical protein AMTR_s00001p00085970 [A... 60 3e-07 ref|XP_007033731.1| Plant stearoyl-acyl-carrier-protein desatura... 60 3e-07 ref|XP_004505150.1| PREDICTED: acyl-[acyl-carrier-protein] desat... 60 3e-07 gb|AAD33903.1| delta-9-stearoyl desaturase [Elaeis guineensis] 60 3e-07 gb|AAF15308.1| stearoyl-acyl-carrier-protein desaturase [Persea ... 60 3e-07 gb|AAA61558.1| delta-9 stearoyl-acyl carrier protein desaturase,... 60 3e-07 gb|AAY86086.1| stearoyl-ACP desaturase [Jatropha curcas] 60 3e-07 gb|AAA74692.1| stearoyl-acyl-carrier protein desaturase, partial... 60 3e-07 pdb|1OQ4|A Chain A, The Crystal Structure Of The Complex Between... 60 3e-07 gb|AFT92043.1| stearoyl-acyl-carrier protein desaturase [Manihot... 60 3e-07 ref|XP_002274708.2| PREDICTED: acyl-[acyl-carrier-protein] desat... 60 3e-07 ref|XP_003608082.1| Stearoyl acyl carrier protein desaturase [Me... 60 3e-07 >ref|XP_002531889.1| Stearoy-ACP desaturase [Ricinus communis] gi|134945|sp|P22337.1|STAD_RICCO RecName: Full=Acyl-[acyl-carrier-protein] desaturase, chloroplastic; AltName: Full=Delta(9) stearoyl-acyl carrier protein desaturase; AltName: Full=Stearoyl-ACP desaturase; Flags: Precursor gi|21093|emb|CAA39859.1| acyl-[acyl-carrier protein] desatu [Ricinus communis] gi|223528456|gb|EEF30488.1| Stearoy-ACP desaturase [Ricinus communis] gi|228313|prf||1802405A stearoyl acyl carrier desaturase Length = 396 Score = 60.1 bits (144), Expect = 3e-07 Identities = 31/38 (81%), Positives = 31/38 (81%) Frame = +3 Query: 3 NKYLYLSGRVDMRQIEKTIQYLIGSGMVRLIYFSSYLG 116 NKYLYLSGRVDMRQIEKTIQYLIGSGM S YLG Sbjct: 184 NKYLYLSGRVDMRQIEKTIQYLIGSGMDPRTENSPYLG 221 >dbj|BAA07681.1| stearoyl-acyl carrier protein desaturase [Sesamum indicum] Length = 396 Score = 60.1 bits (144), Expect = 3e-07 Identities = 31/38 (81%), Positives = 31/38 (81%) Frame = +3 Query: 3 NKYLYLSGRVDMRQIEKTIQYLIGSGMVRLIYFSSYLG 116 NKYLYLSGRVDMRQIEKTIQYLIGSGM S YLG Sbjct: 184 NKYLYLSGRVDMRQIEKTIQYLIGSGMDPRTENSPYLG 221 >dbj|BAA08635.1| stearoyl-acyl carrier protein desaturase [Sesamum indicum] Length = 396 Score = 60.1 bits (144), Expect = 3e-07 Identities = 31/38 (81%), Positives = 31/38 (81%) Frame = +3 Query: 3 NKYLYLSGRVDMRQIEKTIQYLIGSGMVRLIYFSSYLG 116 NKYLYLSGRVDMRQIEKTIQYLIGSGM S YLG Sbjct: 184 NKYLYLSGRVDMRQIEKTIQYLIGSGMDPRTENSPYLG 221 >pdb|1AFR|A Chain A, Stearoyl-Acyl Carrier Protein Desaturase From Castor Seeds gi|2194094|pdb|1AFR|B Chain B, Stearoyl-Acyl Carrier Protein Desaturase From Castor Seeds gi|2194095|pdb|1AFR|C Chain C, Stearoyl-Acyl Carrier Protein Desaturase From Castor Seeds gi|2194096|pdb|1AFR|D Chain D, Stearoyl-Acyl Carrier Protein Desaturase From Castor Seeds gi|2194097|pdb|1AFR|E Chain E, Stearoyl-Acyl Carrier Protein Desaturase From Castor Seeds gi|2194098|pdb|1AFR|F Chain F, Stearoyl-Acyl Carrier Protein Desaturase From Castor Seeds Length = 345 Score = 60.1 bits (144), Expect = 3e-07 Identities = 31/38 (81%), Positives = 31/38 (81%) Frame = +3 Query: 3 NKYLYLSGRVDMRQIEKTIQYLIGSGMVRLIYFSSYLG 116 NKYLYLSGRVDMRQIEKTIQYLIGSGM S YLG Sbjct: 133 NKYLYLSGRVDMRQIEKTIQYLIGSGMDPRTENSPYLG 170 >ref|XP_006494043.1| PREDICTED: acyl-[acyl-carrier-protein] desaturase, chloroplastic-like [Citrus sinensis] Length = 396 Score = 60.1 bits (144), Expect = 3e-07 Identities = 31/38 (81%), Positives = 31/38 (81%) Frame = +3 Query: 3 NKYLYLSGRVDMRQIEKTIQYLIGSGMVRLIYFSSYLG 116 NKYLYLSGRVDMRQIEKTIQYLIGSGM S YLG Sbjct: 184 NKYLYLSGRVDMRQIEKTIQYLIGSGMDPRTENSPYLG 221 >ref|XP_006442769.1| hypothetical protein CICLE_v10020487mg [Citrus clementina] gi|557545031|gb|ESR56009.1| hypothetical protein CICLE_v10020487mg [Citrus clementina] Length = 396 Score = 60.1 bits (144), Expect = 3e-07 Identities = 31/38 (81%), Positives = 31/38 (81%) Frame = +3 Query: 3 NKYLYLSGRVDMRQIEKTIQYLIGSGMVRLIYFSSYLG 116 NKYLYLSGRVDMRQIEKTIQYLIGSGM S YLG Sbjct: 184 NKYLYLSGRVDMRQIEKTIQYLIGSGMDPRTENSPYLG 221 >ref|XP_006376444.1| hypothetical protein POPTR_0013s13100g [Populus trichocarpa] gi|550325720|gb|ERP54241.1| hypothetical protein POPTR_0013s13100g [Populus trichocarpa] Length = 370 Score = 60.1 bits (144), Expect = 3e-07 Identities = 31/38 (81%), Positives = 31/38 (81%) Frame = +3 Query: 3 NKYLYLSGRVDMRQIEKTIQYLIGSGMVRLIYFSSYLG 116 NKYLYLSGRVDMRQIEKTIQYLIGSGM S YLG Sbjct: 158 NKYLYLSGRVDMRQIEKTIQYLIGSGMDPRTENSPYLG 195 >ref|XP_006828767.1| hypothetical protein AMTR_s00001p00087250 [Amborella trichopoda] gi|548833746|gb|ERM96183.1| hypothetical protein AMTR_s00001p00087250 [Amborella trichopoda] Length = 261 Score = 60.1 bits (144), Expect = 3e-07 Identities = 31/38 (81%), Positives = 31/38 (81%) Frame = +3 Query: 3 NKYLYLSGRVDMRQIEKTIQYLIGSGMVRLIYFSSYLG 116 NKYLYLSGRVDMRQIEKTIQYLIGSGM S YLG Sbjct: 50 NKYLYLSGRVDMRQIEKTIQYLIGSGMDPRTENSPYLG 87 >ref|XP_006828766.1| hypothetical protein AMTR_s00001p00085970 [Amborella trichopoda] gi|548833745|gb|ERM96182.1| hypothetical protein AMTR_s00001p00085970 [Amborella trichopoda] Length = 392 Score = 60.1 bits (144), Expect = 3e-07 Identities = 31/38 (81%), Positives = 31/38 (81%) Frame = +3 Query: 3 NKYLYLSGRVDMRQIEKTIQYLIGSGMVRLIYFSSYLG 116 NKYLYLSGRVDMRQIEKTIQYLIGSGM S YLG Sbjct: 180 NKYLYLSGRVDMRQIEKTIQYLIGSGMDPRTENSPYLG 217 >ref|XP_007033731.1| Plant stearoyl-acyl-carrier-protein desaturase family protein [Theobroma cacao] gi|508712760|gb|EOY04657.1| Plant stearoyl-acyl-carrier-protein desaturase family protein [Theobroma cacao] Length = 457 Score = 60.1 bits (144), Expect = 3e-07 Identities = 31/38 (81%), Positives = 31/38 (81%) Frame = +3 Query: 3 NKYLYLSGRVDMRQIEKTIQYLIGSGMVRLIYFSSYLG 116 NKYLYLSGRVDMRQIEKTIQYLIGSGM S YLG Sbjct: 245 NKYLYLSGRVDMRQIEKTIQYLIGSGMDPRTENSPYLG 282 >ref|XP_004505150.1| PREDICTED: acyl-[acyl-carrier-protein] desaturase, chloroplastic-like [Cicer arietinum] Length = 393 Score = 60.1 bits (144), Expect = 3e-07 Identities = 31/38 (81%), Positives = 31/38 (81%) Frame = +3 Query: 3 NKYLYLSGRVDMRQIEKTIQYLIGSGMVRLIYFSSYLG 116 NKYLYLSGRVDMRQIEKTIQYLIGSGM S YLG Sbjct: 181 NKYLYLSGRVDMRQIEKTIQYLIGSGMDPRTENSPYLG 218 >gb|AAD33903.1| delta-9-stearoyl desaturase [Elaeis guineensis] Length = 161 Score = 60.1 bits (144), Expect = 3e-07 Identities = 31/38 (81%), Positives = 31/38 (81%) Frame = +3 Query: 3 NKYLYLSGRVDMRQIEKTIQYLIGSGMVRLIYFSSYLG 116 NKYLYLSGRVDMRQIEKTIQYLIGSGM S YLG Sbjct: 11 NKYLYLSGRVDMRQIEKTIQYLIGSGMDPRTENSPYLG 48 >gb|AAF15308.1| stearoyl-acyl-carrier-protein desaturase [Persea americana] Length = 396 Score = 60.1 bits (144), Expect = 3e-07 Identities = 31/38 (81%), Positives = 31/38 (81%) Frame = +3 Query: 3 NKYLYLSGRVDMRQIEKTIQYLIGSGMVRLIYFSSYLG 116 NKYLYLSGRVDMRQIEKTIQYLIGSGM S YLG Sbjct: 184 NKYLYLSGRVDMRQIEKTIQYLIGSGMDPRTENSPYLG 221 >gb|AAA61558.1| delta-9 stearoyl-acyl carrier protein desaturase, partial [Thunbergia alata] Length = 358 Score = 60.1 bits (144), Expect = 3e-07 Identities = 31/38 (81%), Positives = 31/38 (81%) Frame = +3 Query: 3 NKYLYLSGRVDMRQIEKTIQYLIGSGMVRLIYFSSYLG 116 NKYLYLSGRVDMRQIEKTIQYLIGSGM S YLG Sbjct: 146 NKYLYLSGRVDMRQIEKTIQYLIGSGMDPRTENSPYLG 183 >gb|AAY86086.1| stearoyl-ACP desaturase [Jatropha curcas] Length = 396 Score = 60.1 bits (144), Expect = 3e-07 Identities = 31/38 (81%), Positives = 31/38 (81%) Frame = +3 Query: 3 NKYLYLSGRVDMRQIEKTIQYLIGSGMVRLIYFSSYLG 116 NKYLYLSGRVDMRQIEKTIQYLIGSGM S YLG Sbjct: 184 NKYLYLSGRVDMRQIEKTIQYLIGSGMDPRTENSPYLG 221 >gb|AAA74692.1| stearoyl-acyl-carrier protein desaturase, partial [Ricinus communis] Length = 412 Score = 60.1 bits (144), Expect = 3e-07 Identities = 31/38 (81%), Positives = 31/38 (81%) Frame = +3 Query: 3 NKYLYLSGRVDMRQIEKTIQYLIGSGMVRLIYFSSYLG 116 NKYLYLSGRVDMRQIEKTIQYLIGSGM S YLG Sbjct: 200 NKYLYLSGRVDMRQIEKTIQYLIGSGMDPRTENSPYLG 237 >pdb|1OQ4|A Chain A, The Crystal Structure Of The Complex Between Stearoyl Acyl Carrier Protein Desaturase From Ricinus Communis (Castor Bean) And Azide. gi|31615833|pdb|1OQ4|B Chain B, The Crystal Structure Of The Complex Between Stearoyl Acyl Carrier Protein Desaturase From Ricinus Communis (Castor Bean) And Azide. gi|31615834|pdb|1OQ4|C Chain C, The Crystal Structure Of The Complex Between Stearoyl Acyl Carrier Protein Desaturase From Ricinus Communis (Castor Bean) And Azide. gi|31615835|pdb|1OQ4|D Chain D, The Crystal Structure Of The Complex Between Stearoyl Acyl Carrier Protein Desaturase From Ricinus Communis (Castor Bean) And Azide. gi|31615836|pdb|1OQ4|E Chain E, The Crystal Structure Of The Complex Between Stearoyl Acyl Carrier Protein Desaturase From Ricinus Communis (Castor Bean) And Azide. gi|31615837|pdb|1OQ4|F Chain F, The Crystal Structure Of The Complex Between Stearoyl Acyl Carrier Protein Desaturase From Ricinus Communis (Castor Bean) And Azide. gi|31615838|pdb|1OQ7|A Chain A, The Crystal Structure Of The Iron Free (apo-)form Of Stearoyl Acyl Carrier Protein Desaturase From Ricinus Communis (castor Bean). gi|31615839|pdb|1OQ7|B Chain B, The Crystal Structure Of The Iron Free (apo-)form Of Stearoyl Acyl Carrier Protein Desaturase From Ricinus Communis (castor Bean). gi|31615840|pdb|1OQ7|C Chain C, The Crystal Structure Of The Iron Free (apo-)form Of Stearoyl Acyl Carrier Protein Desaturase From Ricinus Communis (castor Bean). gi|31615841|pdb|1OQ7|D Chain D, The Crystal Structure Of The Iron Free (apo-)form Of Stearoyl Acyl Carrier Protein Desaturase From Ricinus Communis (castor Bean). gi|31615842|pdb|1OQ7|E Chain E, The Crystal Structure Of The Iron Free (apo-)form Of Stearoyl Acyl Carrier Protein Desaturase From Ricinus Communis (castor Bean). gi|31615843|pdb|1OQ7|F Chain F, The Crystal Structure Of The Iron Free (apo-)form Of Stearoyl Acyl Carrier Protein Desaturase From Ricinus Communis (castor Bean). gi|31615844|pdb|1OQ9|A Chain A, The Crystal Structure Of The Complex Between Stearoyl Acyl Carrier Protein Desaturase From Ricinus Communis (Castor Bean) And Acetate. gi|31615845|pdb|1OQB|A Chain A, The Crystal Structure Of The One-iron Form Of The Di-iron Center In Stearoyl Acyl Carrier Protein Desaturase From Ricinus Communis (castor Bean). gi|31615846|pdb|1OQB|B Chain B, The Crystal Structure Of The One-iron Form Of The Di-iron Center In Stearoyl Acyl Carrier Protein Desaturase From Ricinus Communis (castor Bean). gi|31615847|pdb|1OQB|C Chain C, The Crystal Structure Of The One-iron Form Of The Di-iron Center In Stearoyl Acyl Carrier Protein Desaturase From Ricinus Communis (castor Bean). gi|31615848|pdb|1OQB|D Chain D, The Crystal Structure Of The One-iron Form Of The Di-iron Center In Stearoyl Acyl Carrier Protein Desaturase From Ricinus Communis (castor Bean). gi|31615849|pdb|1OQB|E Chain E, The Crystal Structure Of The One-iron Form Of The Di-iron Center In Stearoyl Acyl Carrier Protein Desaturase From Ricinus Communis (castor Bean). gi|31615850|pdb|1OQB|F Chain F, The Crystal Structure Of The One-iron Form Of The Di-iron Center In Stearoyl Acyl Carrier Protein Desaturase From Ricinus Communis (castor Bean). gi|345531619|pdb|2XZ0|A Chain A, The Structure Of The 2:1 (Partially Occupied) Complex Between Stearoyl Acyl Carrier Protein Desaturase From Ricinus Communis (Castor Bean) And Acyl Carrier Protein. gi|345531620|pdb|2XZ0|B Chain B, The Structure Of The 2:1 (Partially Occupied) Complex Between Stearoyl Acyl Carrier Protein Desaturase From Ricinus Communis (Castor Bean) And Acyl Carrier Protein. gi|345531621|pdb|2XZ0|C Chain C, The Structure Of The 2:1 (Partially Occupied) Complex Between Stearoyl Acyl Carrier Protein Desaturase From Ricinus Communis (Castor Bean) And Acyl Carrier Protein. gi|345531623|pdb|2XZ1|A Chain A, The Structure Of The 2:2 (Fully Occupied) Complex Between Stearoyl Acyl Carrier Protein Desaturase From Ricinus Communis (Castor Bean) And Acyl Carrier Protein. gi|345531624|pdb|2XZ1|B Chain B, The Structure Of The 2:2 (Fully Occupied) Complex Between Stearoyl Acyl Carrier Protein Desaturase From Ricinus Communis (Castor Bean) And Acyl Carrier Protein Length = 363 Score = 60.1 bits (144), Expect = 3e-07 Identities = 31/38 (81%), Positives = 31/38 (81%) Frame = +3 Query: 3 NKYLYLSGRVDMRQIEKTIQYLIGSGMVRLIYFSSYLG 116 NKYLYLSGRVDMRQIEKTIQYLIGSGM S YLG Sbjct: 151 NKYLYLSGRVDMRQIEKTIQYLIGSGMDPRTENSPYLG 188 >gb|AFT92043.1| stearoyl-acyl-carrier protein desaturase [Manihot esculenta] Length = 398 Score = 60.1 bits (144), Expect = 3e-07 Identities = 31/38 (81%), Positives = 31/38 (81%) Frame = +3 Query: 3 NKYLYLSGRVDMRQIEKTIQYLIGSGMVRLIYFSSYLG 116 NKYLYLSGRVDMRQIEKTIQYLIGSGM S YLG Sbjct: 184 NKYLYLSGRVDMRQIEKTIQYLIGSGMDPRTENSPYLG 221 >ref|XP_002274708.2| PREDICTED: acyl-[acyl-carrier-protein] desaturase, chloroplastic-like [Vitis vinifera] Length = 396 Score = 60.1 bits (144), Expect = 3e-07 Identities = 31/38 (81%), Positives = 31/38 (81%) Frame = +3 Query: 3 NKYLYLSGRVDMRQIEKTIQYLIGSGMVRLIYFSSYLG 116 NKYLYLSGRVDMRQIEKTIQYLIGSGM S YLG Sbjct: 184 NKYLYLSGRVDMRQIEKTIQYLIGSGMDPRTENSPYLG 221 >ref|XP_003608082.1| Stearoyl acyl carrier protein desaturase [Medicago truncatula] gi|355509137|gb|AES90279.1| Stearoyl acyl carrier protein desaturase [Medicago truncatula] Length = 393 Score = 60.1 bits (144), Expect = 3e-07 Identities = 31/38 (81%), Positives = 31/38 (81%) Frame = +3 Query: 3 NKYLYLSGRVDMRQIEKTIQYLIGSGMVRLIYFSSYLG 116 NKYLYLSGRVDMRQIEKTIQYLIGSGM S YLG Sbjct: 181 NKYLYLSGRVDMRQIEKTIQYLIGSGMDPRTENSPYLG 218