BLASTX nr result
ID: Mentha29_contig00036940
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00036940 (301 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU30233.1| hypothetical protein MIMGU_mgv1a025867mg, partial... 63 5e-08 >gb|EYU30233.1| hypothetical protein MIMGU_mgv1a025867mg, partial [Mimulus guttatus] Length = 424 Score = 62.8 bits (151), Expect = 5e-08 Identities = 28/37 (75%), Positives = 31/37 (83%) Frame = +1 Query: 13 SDTGIGSNLEEFHELKYENNTILSGKWDGVLSVMTTS 123 SDTGIGS LEEF +LKY+NN IL GKWDGVL + TTS Sbjct: 1 SDTGIGSTLEEFQQLKYQNNPILDGKWDGVLCIATTS 37