BLASTX nr result
ID: Mentha29_contig00036805
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00036805 (316 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU40913.1| hypothetical protein MIMGU_mgv1a025482mg [Mimulus... 58 2e-06 >gb|EYU40913.1| hypothetical protein MIMGU_mgv1a025482mg [Mimulus guttatus] Length = 256 Score = 57.8 bits (138), Expect = 2e-06 Identities = 25/41 (60%), Positives = 35/41 (85%) Frame = +2 Query: 194 MSQEKPERRGDPIRYGDVFSVSGELAAKPITTRDAAAVESA 316 MSQE+P R GD ++YGDVF VSG+LA++PI +DAAA+++A Sbjct: 1 MSQEQPRRPGDAVKYGDVFDVSGQLASQPIAPQDAAALQAA 41