BLASTX nr result
ID: Mentha29_contig00036537
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00036537 (596 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU25079.1| hypothetical protein MIMGU_mgv11b021680mg [Mimulu... 57 3e-06 >gb|EYU25079.1| hypothetical protein MIMGU_mgv11b021680mg [Mimulus guttatus] Length = 330 Score = 57.4 bits (137), Expect = 3e-06 Identities = 25/36 (69%), Positives = 29/36 (80%) Frame = +2 Query: 488 FCEMDVEHPEWLPVDWKVCVRVRSSGKKDKYYVNPS 595 F EM E +WLPV W+V V+VR+SGKKDKYYVNPS Sbjct: 59 FIEMGGESLDWLPVGWRVSVKVRNSGKKDKYYVNPS 94