BLASTX nr result
ID: Mentha29_contig00036407
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00036407 (405 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU32103.1| hypothetical protein MIMGU_mgv1a024967mg [Mimulus... 71 2e-10 gb|EYU32105.1| hypothetical protein MIMGU_mgv1a018691mg [Mimulus... 70 3e-10 ref|XP_004231182.1| PREDICTED: putative ripening-related protein... 70 4e-10 ref|XP_006339790.1| PREDICTED: putative ripening-related protein... 69 5e-10 ref|XP_007139878.1| hypothetical protein PHAVU_008G066000g [Phas... 69 5e-10 ref|XP_007051837.1| Ripening-related protein 1 [Theobroma cacao]... 69 5e-10 ref|XP_003521892.2| PREDICTED: putative ripening-related protein... 69 7e-10 ref|XP_003521894.2| PREDICTED: putative ripening-related protein... 69 7e-10 ref|XP_003521901.2| PREDICTED: putative ripening-related protein... 69 7e-10 ref|XP_006445077.1| hypothetical protein CICLE_v10023491mg [Citr... 69 7e-10 ref|XP_003533611.2| PREDICTED: LOW QUALITY PROTEIN: putative rip... 69 9e-10 ref|XP_006445076.1| hypothetical protein CICLE_v10023417mg [Citr... 69 9e-10 ref|XP_006339789.1| PREDICTED: uncharacterized protein LOC102580... 68 1e-09 ref|XP_007021719.1| Ripening-related protein 1 [Theobroma cacao]... 68 1e-09 ref|XP_003552385.1| PREDICTED: putative ripening-related protein... 68 1e-09 ref|XP_007135042.1| hypothetical protein PHAVU_010G096700g [Phas... 68 1e-09 ref|XP_006432702.1| hypothetical protein CICLE_v10003380mg [Citr... 67 2e-09 ref|XP_003623915.1| Ripening-related protein [Medicago truncatul... 67 3e-09 gb|EXC06840.1| hypothetical protein L484_017306 [Morus notabilis] 67 3e-09 gb|EXB66351.1| hypothetical protein L484_008096 [Morus notabilis] 67 3e-09 >gb|EYU32103.1| hypothetical protein MIMGU_mgv1a024967mg [Mimulus guttatus] Length = 187 Score = 70.9 bits (172), Expect = 2e-10 Identities = 29/39 (74%), Positives = 33/39 (84%) Frame = +2 Query: 287 EGRLQSCNPSGRIIGKKPPPGQCNQENNSDCCKQGKPYT 403 + RLQSCNPSG+I G+ PPPGQCNQEN+SDCCK G YT Sbjct: 22 QARLQSCNPSGKIRGENPPPGQCNQENDSDCCKAGDYYT 60 >gb|EYU32105.1| hypothetical protein MIMGU_mgv1a018691mg [Mimulus guttatus] Length = 185 Score = 70.1 bits (170), Expect = 3e-10 Identities = 29/37 (78%), Positives = 32/37 (86%) Frame = +2 Query: 293 RLQSCNPSGRIIGKKPPPGQCNQENNSDCCKQGKPYT 403 RLQSCNPSG+I G+ PPPGQCNQEN+SDCCK G YT Sbjct: 22 RLQSCNPSGKIRGENPPPGQCNQENDSDCCKAGDYYT 58 >ref|XP_004231182.1| PREDICTED: putative ripening-related protein 1-like [Solanum lycopersicum] Length = 349 Score = 69.7 bits (169), Expect = 4e-10 Identities = 29/39 (74%), Positives = 32/39 (82%) Frame = +2 Query: 287 EGRLQSCNPSGRIIGKKPPPGQCNQENNSDCCKQGKPYT 403 + RLQ C PSG+I G KPPPGQCN EN+SDCCKQGK YT Sbjct: 24 DARLQGCQPSGKIRGIKPPPGQCNPENDSDCCKQGKLYT 62 Score = 62.8 bits (151), Expect = 5e-08 Identities = 26/34 (76%), Positives = 28/34 (82%) Frame = +2 Query: 302 SCNPSGRIIGKKPPPGQCNQENNSDCCKQGKPYT 403 +C PSG I G KPPPGQCN EN+SDCCKQGK YT Sbjct: 189 ACQPSGSIRGIKPPPGQCNPENDSDCCKQGKIYT 222 >ref|XP_006339790.1| PREDICTED: putative ripening-related protein 1-like [Solanum tuberosum] Length = 189 Score = 69.3 bits (168), Expect = 5e-10 Identities = 29/39 (74%), Positives = 32/39 (82%) Frame = +2 Query: 287 EGRLQSCNPSGRIIGKKPPPGQCNQENNSDCCKQGKPYT 403 + RLQ+C PSG I G KPPPGQCN EN+SDCCKQGK YT Sbjct: 24 DARLQACQPSGSIRGIKPPPGQCNPENDSDCCKQGKMYT 62 >ref|XP_007139878.1| hypothetical protein PHAVU_008G066000g [Phaseolus vulgaris] gi|561013011|gb|ESW11872.1| hypothetical protein PHAVU_008G066000g [Phaseolus vulgaris] Length = 188 Score = 69.3 bits (168), Expect = 5e-10 Identities = 29/39 (74%), Positives = 31/39 (79%) Frame = +2 Query: 287 EGRLQSCNPSGRIIGKKPPPGQCNQENNSDCCKQGKPYT 403 E Q C PSGRI GKK PPGQCNQEN+SDCCK+GK YT Sbjct: 23 ESEAQKCRPSGRIRGKKAPPGQCNQENDSDCCKEGKLYT 61 >ref|XP_007051837.1| Ripening-related protein 1 [Theobroma cacao] gi|508704098|gb|EOX95994.1| Ripening-related protein 1 [Theobroma cacao] Length = 187 Score = 69.3 bits (168), Expect = 5e-10 Identities = 28/35 (80%), Positives = 31/35 (88%) Frame = +2 Query: 299 QSCNPSGRIIGKKPPPGQCNQENNSDCCKQGKPYT 403 Q+CNPSG+I GK PPPGQCNQEN+SDCCK GK YT Sbjct: 25 QTCNPSGKIRGKNPPPGQCNQENDSDCCKDGKWYT 59 >ref|XP_003521892.2| PREDICTED: putative ripening-related protein 1-like [Glycine max] Length = 348 Score = 68.9 bits (167), Expect = 7e-10 Identities = 27/35 (77%), Positives = 31/35 (88%) Frame = +2 Query: 299 QSCNPSGRIIGKKPPPGQCNQENNSDCCKQGKPYT 403 Q C PSGRI+GKKPPPG+CN+EN+SDCC QGK YT Sbjct: 27 QQCRPSGRIMGKKPPPGECNKENDSDCCVQGKAYT 61 Score = 67.8 bits (164), Expect = 1e-09 Identities = 26/35 (74%), Positives = 31/35 (88%) Frame = +2 Query: 299 QSCNPSGRIIGKKPPPGQCNQENNSDCCKQGKPYT 403 + C PSGRI+GKKPPPG+CN+EN+SDCC QGK YT Sbjct: 187 EQCRPSGRIMGKKPPPGECNKENDSDCCVQGKAYT 221 >ref|XP_003521894.2| PREDICTED: putative ripening-related protein 1-like [Glycine max] Length = 188 Score = 68.9 bits (167), Expect = 7e-10 Identities = 27/35 (77%), Positives = 31/35 (88%) Frame = +2 Query: 299 QSCNPSGRIIGKKPPPGQCNQENNSDCCKQGKPYT 403 Q C PSGRI+GKKPPPG+CN+EN+SDCC QGK YT Sbjct: 27 QQCRPSGRIMGKKPPPGECNKENDSDCCVQGKAYT 61 >ref|XP_003521901.2| PREDICTED: putative ripening-related protein 1-like [Glycine max] gi|571443876|ref|XP_003521903.2| PREDICTED: putative ripening-related protein 1-like [Glycine max] Length = 187 Score = 68.9 bits (167), Expect = 7e-10 Identities = 27/35 (77%), Positives = 31/35 (88%) Frame = +2 Query: 299 QSCNPSGRIIGKKPPPGQCNQENNSDCCKQGKPYT 403 Q C PSGRI+GKKPPPG+CN+EN+SDCC QGK YT Sbjct: 26 QQCRPSGRIMGKKPPPGECNKENDSDCCVQGKAYT 60 >ref|XP_006445077.1| hypothetical protein CICLE_v10023491mg [Citrus clementina] gi|557547339|gb|ESR58317.1| hypothetical protein CICLE_v10023491mg [Citrus clementina] Length = 186 Score = 68.9 bits (167), Expect = 7e-10 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = +2 Query: 302 SCNPSGRIIGKKPPPGQCNQENNSDCCKQGKPYT 403 +CNPSG+I GKKPPPGQCNQEN SDCCKQGK Y+ Sbjct: 27 TCNPSGKIRGKKPPPGQCNQENYSDCCKQGKLYS 60 >ref|XP_003533611.2| PREDICTED: LOW QUALITY PROTEIN: putative ripening-related protein 5-like [Glycine max] Length = 353 Score = 68.6 bits (166), Expect = 9e-10 Identities = 28/35 (80%), Positives = 32/35 (91%) Frame = +2 Query: 299 QSCNPSGRIIGKKPPPGQCNQENNSDCCKQGKPYT 403 +SC+PSGRI GKK PPGQCNQEN+SDCCK+GK YT Sbjct: 192 KSCHPSGRIRGKKAPPGQCNQENDSDCCKEGKMYT 226 Score = 66.6 bits (161), Expect = 3e-09 Identities = 27/35 (77%), Positives = 30/35 (85%) Frame = +2 Query: 299 QSCNPSGRIIGKKPPPGQCNQENNSDCCKQGKPYT 403 Q C PSGRI GKK PPGQCNQEN+SDCC++GK YT Sbjct: 27 QKCRPSGRIRGKKAPPGQCNQENDSDCCEEGKMYT 61 >ref|XP_006445076.1| hypothetical protein CICLE_v10023417mg [Citrus clementina] gi|557547338|gb|ESR58316.1| hypothetical protein CICLE_v10023417mg [Citrus clementina] Length = 189 Score = 68.6 bits (166), Expect = 9e-10 Identities = 27/34 (79%), Positives = 31/34 (91%) Frame = +2 Query: 302 SCNPSGRIIGKKPPPGQCNQENNSDCCKQGKPYT 403 +C PSG+I GKKPPPGQCN+ENNSDCCK+GK YT Sbjct: 30 TCKPSGKIRGKKPPPGQCNKENNSDCCKEGKLYT 63 >ref|XP_006339789.1| PREDICTED: uncharacterized protein LOC102580900 [Solanum tuberosum] Length = 345 Score = 68.2 bits (165), Expect = 1e-09 Identities = 28/39 (71%), Positives = 32/39 (82%) Frame = +2 Query: 287 EGRLQSCNPSGRIIGKKPPPGQCNQENNSDCCKQGKPYT 403 + RLQ+C PSG+I G PPPGQCN EN+SDCCKQGK YT Sbjct: 20 DARLQACQPSGKIRGIMPPPGQCNPENDSDCCKQGKMYT 58 Score = 64.3 bits (155), Expect = 2e-08 Identities = 26/34 (76%), Positives = 29/34 (85%) Frame = +2 Query: 302 SCNPSGRIIGKKPPPGQCNQENNSDCCKQGKPYT 403 +C PSG+I G KPPPGQCN EN+SDCCKQGK YT Sbjct: 185 ACQPSGKIRGIKPPPGQCNPENDSDCCKQGKMYT 218 >ref|XP_007021719.1| Ripening-related protein 1 [Theobroma cacao] gi|508721347|gb|EOY13244.1| Ripening-related protein 1 [Theobroma cacao] Length = 188 Score = 68.2 bits (165), Expect = 1e-09 Identities = 27/35 (77%), Positives = 32/35 (91%) Frame = +2 Query: 299 QSCNPSGRIIGKKPPPGQCNQENNSDCCKQGKPYT 403 QSC PSG+I GKKPPPG+CN+EN+SDCCK+GK YT Sbjct: 25 QSCKPSGKIRGKKPPPGKCNRENDSDCCKEGKLYT 59 >ref|XP_003552385.1| PREDICTED: putative ripening-related protein 1-like [Glycine max] Length = 188 Score = 68.2 bits (165), Expect = 1e-09 Identities = 28/35 (80%), Positives = 30/35 (85%) Frame = +2 Query: 299 QSCNPSGRIIGKKPPPGQCNQENNSDCCKQGKPYT 403 Q C PSGRI GKK PPGQCNQEN+SDCCK+GK YT Sbjct: 27 QKCRPSGRIRGKKAPPGQCNQENDSDCCKEGKMYT 61 >ref|XP_007135042.1| hypothetical protein PHAVU_010G096700g [Phaseolus vulgaris] gi|593265730|ref|XP_007135043.1| hypothetical protein PHAVU_010G096800g [Phaseolus vulgaris] gi|561008087|gb|ESW07036.1| hypothetical protein PHAVU_010G096700g [Phaseolus vulgaris] gi|561008088|gb|ESW07037.1| hypothetical protein PHAVU_010G096800g [Phaseolus vulgaris] Length = 188 Score = 67.8 bits (164), Expect = 1e-09 Identities = 27/35 (77%), Positives = 30/35 (85%) Frame = +2 Query: 299 QSCNPSGRIIGKKPPPGQCNQENNSDCCKQGKPYT 403 Q C PSGRI GKKPPPG+CNQEN+S+CC QGK YT Sbjct: 27 QQCRPSGRITGKKPPPGECNQENDSECCVQGKMYT 61 >ref|XP_006432702.1| hypothetical protein CICLE_v10003380mg [Citrus clementina] gi|568834806|ref|XP_006471493.1| PREDICTED: putative ripening-related protein 1-like [Citrus sinensis] gi|557534824|gb|ESR45942.1| hypothetical protein CICLE_v10003380mg [Citrus clementina] Length = 188 Score = 67.4 bits (163), Expect = 2e-09 Identities = 27/34 (79%), Positives = 31/34 (91%) Frame = +2 Query: 302 SCNPSGRIIGKKPPPGQCNQENNSDCCKQGKPYT 403 +CNPSG+I GKKPPPGQCN+EN SDCCKQGK Y+ Sbjct: 29 TCNPSGKIRGKKPPPGQCNKENYSDCCKQGKLYS 62 >ref|XP_003623915.1| Ripening-related protein [Medicago truncatula] gi|355498930|gb|AES80133.1| Ripening-related protein [Medicago truncatula] Length = 353 Score = 67.0 bits (162), Expect = 3e-09 Identities = 28/35 (80%), Positives = 30/35 (85%) Frame = +2 Query: 299 QSCNPSGRIIGKKPPPGQCNQENNSDCCKQGKPYT 403 Q+C PSGRI GKK PPGQCNQEN+SDCC QGK YT Sbjct: 28 QNCRPSGRIRGKKAPPGQCNQENDSDCCVQGKMYT 62 >gb|EXC06840.1| hypothetical protein L484_017306 [Morus notabilis] Length = 185 Score = 66.6 bits (161), Expect = 3e-09 Identities = 27/35 (77%), Positives = 31/35 (88%) Frame = +2 Query: 296 LQSCNPSGRIIGKKPPPGQCNQENNSDCCKQGKPY 400 ++SC PSGRI GKKPPPG+CNQEN SDCCK+GK Y Sbjct: 23 VESCKPSGRIRGKKPPPGECNQENYSDCCKKGKFY 57 >gb|EXB66351.1| hypothetical protein L484_008096 [Morus notabilis] Length = 185 Score = 66.6 bits (161), Expect = 3e-09 Identities = 27/35 (77%), Positives = 31/35 (88%) Frame = +2 Query: 296 LQSCNPSGRIIGKKPPPGQCNQENNSDCCKQGKPY 400 ++SC PSGRI GKKPPPG+CNQEN SDCCK+GK Y Sbjct: 23 VESCKPSGRIRGKKPPPGECNQENYSDCCKKGKFY 57