BLASTX nr result
ID: Mentha29_contig00036240
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00036240 (337 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004304349.1| PREDICTED: villin-2-like [Fragaria vesca sub... 55 8e-06 >ref|XP_004304349.1| PREDICTED: villin-2-like [Fragaria vesca subsp. vesca] Length = 969 Score = 55.5 bits (132), Expect = 8e-06 Identities = 23/31 (74%), Positives = 29/31 (93%) Frame = +2 Query: 2 EFQSIFEMSKEAFYQVPKWKQDLLKKKADLF 94 +FQ+IF M+K+AFYQ+PKWKQD+ KKKADLF Sbjct: 939 DFQTIFGMTKDAFYQLPKWKQDMQKKKADLF 969