BLASTX nr result
ID: Mentha29_contig00036137
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00036137 (408 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU18144.1| hypothetical protein MIMGU_mgv1a004454mg [Mimulus... 80 4e-13 gb|EYU38699.1| hypothetical protein MIMGU_mgv1a004539mg [Mimulus... 72 6e-11 ref|XP_006362296.1| PREDICTED: uncharacterized protein LOC102601... 67 2e-09 ref|XP_007029170.1| Gb:AAF23201.1, putative [Theobroma cacao] gi... 67 2e-09 gb|EXC03802.1| hypothetical protein L484_012413 [Morus notabilis] 65 1e-08 ref|XP_002322760.1| hypothetical protein POPTR_0016s06530g [Popu... 63 5e-08 ref|XP_006407403.1| hypothetical protein EUTSA_v10020560mg [Eutr... 62 6e-08 emb|CBI39097.3| unnamed protein product [Vitis vinifera] 62 8e-08 ref|XP_002267437.1| PREDICTED: uncharacterized protein LOC100254... 62 8e-08 ref|XP_002309271.1| hypothetical protein POPTR_0006s21350g [Popu... 62 8e-08 ref|XP_006339188.1| PREDICTED: uncharacterized protein LOC102592... 62 1e-07 ref|XP_006297466.1| hypothetical protein CARUB_v10013486mg [Caps... 61 1e-07 ref|XP_006481650.1| PREDICTED: uncharacterized protein LOC102615... 61 2e-07 ref|XP_006429996.1| hypothetical protein CICLE_v10011510mg [Citr... 61 2e-07 ref|XP_002884869.1| hypothetical protein ARALYDRAFT_478531 [Arab... 61 2e-07 ref|XP_004494287.1| PREDICTED: uncharacterized protein LOC101514... 60 3e-07 ref|NP_187791.1| uncharacterized protein [Arabidopsis thaliana] ... 60 4e-07 gb|EMT23778.1| hypothetical protein F775_12620 [Aegilops tauschii] 59 7e-07 ref|XP_004249385.1| PREDICTED: uncharacterized protein LOC101267... 59 7e-07 ref|NP_196274.1| uncharacterized protein [Arabidopsis thaliana] ... 58 1e-06 >gb|EYU18144.1| hypothetical protein MIMGU_mgv1a004454mg [Mimulus guttatus] Length = 526 Score = 79.7 bits (195), Expect = 4e-13 Identities = 35/50 (70%), Positives = 40/50 (80%) Frame = -3 Query: 406 FKWIVPIFCWRRKGRRARYMFGLSANNIGLLVLLDRSPRVGLWRHQFITN 257 FKW+VP+ W+RK RR +YMFGLSANN GLL+LLDR PRVG WR F TN Sbjct: 470 FKWLVPLVFWKRKARRCKYMFGLSANNAGLLLLLDRGPRVGQWRCIFSTN 519 >gb|EYU38699.1| hypothetical protein MIMGU_mgv1a004539mg [Mimulus guttatus] Length = 521 Score = 72.4 bits (176), Expect = 6e-11 Identities = 33/44 (75%), Positives = 34/44 (77%) Frame = -3 Query: 406 FKWIVPIFCWRRKGRRARYMFGLSANNIGLLVLLDRSPRVGLWR 275 FKWIV WRRK R +YMFGLSANN GLLVLLDR PRVG WR Sbjct: 468 FKWIVSFVLWRRKASRCKYMFGLSANNEGLLVLLDRGPRVGHWR 511 >ref|XP_006362296.1| PREDICTED: uncharacterized protein LOC102601106 isoform X1 [Solanum tuberosum] gi|565393256|ref|XP_006362297.1| PREDICTED: uncharacterized protein LOC102601106 isoform X2 [Solanum tuberosum] Length = 496 Score = 67.4 bits (163), Expect = 2e-09 Identities = 27/44 (61%), Positives = 34/44 (77%) Frame = -3 Query: 406 FKWIVPIFCWRRKGRRARYMFGLSANNIGLLVLLDRSPRVGLWR 275 FKWI+ WRRK R +Y+FGL+AN +GLL+LLD+ PRVG WR Sbjct: 446 FKWIMSFVLWRRKAHRCKYLFGLTANRVGLLMLLDKGPRVGQWR 489 >ref|XP_007029170.1| Gb:AAF23201.1, putative [Theobroma cacao] gi|508717775|gb|EOY09672.1| Gb:AAF23201.1, putative [Theobroma cacao] Length = 528 Score = 67.4 bits (163), Expect = 2e-09 Identities = 26/44 (59%), Positives = 36/44 (81%) Frame = -3 Query: 406 FKWIVPIFCWRRKGRRARYMFGLSANNIGLLVLLDRSPRVGLWR 275 FKW+V W+RK RR++Y++GLSANN+GLL+LLD+ PR+ WR Sbjct: 478 FKWVVSFIFWKRKARRSKYLYGLSANNVGLLMLLDKGPRLRQWR 521 >gb|EXC03802.1| hypothetical protein L484_012413 [Morus notabilis] Length = 515 Score = 64.7 bits (156), Expect = 1e-08 Identities = 25/44 (56%), Positives = 35/44 (79%) Frame = -3 Query: 406 FKWIVPIFCWRRKGRRARYMFGLSANNIGLLVLLDRSPRVGLWR 275 FKW++ WRRK RR++Y+FG+SAN++GLL+LLD+ PR WR Sbjct: 465 FKWVMSFVFWRRKARRSKYLFGISANSVGLLMLLDKGPRTRHWR 508 >ref|XP_002322760.1| hypothetical protein POPTR_0016s06530g [Populus trichocarpa] gi|222867390|gb|EEF04521.1| hypothetical protein POPTR_0016s06530g [Populus trichocarpa] Length = 535 Score = 62.8 bits (151), Expect = 5e-08 Identities = 25/44 (56%), Positives = 33/44 (75%) Frame = -3 Query: 406 FKWIVPIFCWRRKGRRARYMFGLSANNIGLLVLLDRSPRVGLWR 275 FKW+V WR+K +R++YMFGLSA N+GLL+LLD+ P WR Sbjct: 478 FKWVVSFVFWRKKAQRSKYMFGLSATNVGLLMLLDKGPSTRQWR 521 >ref|XP_006407403.1| hypothetical protein EUTSA_v10020560mg [Eutrema salsugineum] gi|557108549|gb|ESQ48856.1| hypothetical protein EUTSA_v10020560mg [Eutrema salsugineum] Length = 504 Score = 62.4 bits (150), Expect = 6e-08 Identities = 26/44 (59%), Positives = 33/44 (75%) Frame = -3 Query: 406 FKWIVPIFCWRRKGRRARYMFGLSANNIGLLVLLDRSPRVGLWR 275 FKWI WRRK RR++YMFG+SANNIGL ++L++ PR WR Sbjct: 454 FKWITSFVSWRRKARRSKYMFGMSANNIGLQMVLEKVPRSRKWR 497 >emb|CBI39097.3| unnamed protein product [Vitis vinifera] Length = 347 Score = 62.0 bits (149), Expect = 8e-08 Identities = 24/45 (53%), Positives = 35/45 (77%) Frame = -3 Query: 406 FKWIVPIFCWRRKGRRARYMFGLSANNIGLLVLLDRSPRVGLWRH 272 FKWIV W++K R+++YMFGL+ANN+GLL+LLD+ P + W + Sbjct: 293 FKWIVSFNFWKKKARQSKYMFGLTANNVGLLMLLDKGPHMRQWNY 337 >ref|XP_002267437.1| PREDICTED: uncharacterized protein LOC100254774 [Vitis vinifera] Length = 520 Score = 62.0 bits (149), Expect = 8e-08 Identities = 24/45 (53%), Positives = 35/45 (77%) Frame = -3 Query: 406 FKWIVPIFCWRRKGRRARYMFGLSANNIGLLVLLDRSPRVGLWRH 272 FKWIV W++K R+++YMFGL+ANN+GLL+LLD+ P + W + Sbjct: 466 FKWIVSFNFWKKKARQSKYMFGLTANNVGLLMLLDKGPHMRQWNY 510 >ref|XP_002309271.1| hypothetical protein POPTR_0006s21350g [Populus trichocarpa] gi|222855247|gb|EEE92794.1| hypothetical protein POPTR_0006s21350g [Populus trichocarpa] Length = 526 Score = 62.0 bits (149), Expect = 8e-08 Identities = 25/44 (56%), Positives = 34/44 (77%) Frame = -3 Query: 406 FKWIVPIFCWRRKGRRARYMFGLSANNIGLLVLLDRSPRVGLWR 275 FKW+V I WR+K +R++YMFGLSA ++GLL+LLD+ R WR Sbjct: 476 FKWVVSIVLWRKKAQRSKYMFGLSAADVGLLILLDKGSRTRQWR 519 >ref|XP_006339188.1| PREDICTED: uncharacterized protein LOC102592619 isoform X1 [Solanum tuberosum] gi|565344168|ref|XP_006339189.1| PREDICTED: uncharacterized protein LOC102592619 isoform X2 [Solanum tuberosum] Length = 516 Score = 61.6 bits (148), Expect = 1e-07 Identities = 26/44 (59%), Positives = 30/44 (68%) Frame = -3 Query: 406 FKWIVPIFCWRRKGRRARYMFGLSANNIGLLVLLDRSPRVGLWR 275 FKW+ WRRK RR +Y FG S NN GLL+LLD+ P VG WR Sbjct: 466 FKWVTCFVLWRRKARRCKYPFGSSTNNPGLLMLLDKGPHVGQWR 509 >ref|XP_006297466.1| hypothetical protein CARUB_v10013486mg [Capsella rubella] gi|482566175|gb|EOA30364.1| hypothetical protein CARUB_v10013486mg [Capsella rubella] Length = 508 Score = 61.2 bits (147), Expect = 1e-07 Identities = 24/44 (54%), Positives = 33/44 (75%) Frame = -3 Query: 406 FKWIVPIFCWRRKGRRARYMFGLSANNIGLLVLLDRSPRVGLWR 275 FKWI W+RK RR++YMFG+S NN+GL +LL+++PR WR Sbjct: 457 FKWITSFVSWKRKARRSKYMFGMSGNNLGLKMLLEKAPRSQKWR 500 >ref|XP_006481650.1| PREDICTED: uncharacterized protein LOC102615516 [Citrus sinensis] Length = 513 Score = 60.8 bits (146), Expect = 2e-07 Identities = 25/44 (56%), Positives = 32/44 (72%) Frame = -3 Query: 406 FKWIVPIFCWRRKGRRARYMFGLSANNIGLLVLLDRSPRVGLWR 275 FKWI WRRK R++Y GL+ANN+GLL+LLD+ PR+ WR Sbjct: 463 FKWIASFVFWRRKAHRSKYACGLTANNVGLLMLLDKDPRMRKWR 506 >ref|XP_006429996.1| hypothetical protein CICLE_v10011510mg [Citrus clementina] gi|557532053|gb|ESR43236.1| hypothetical protein CICLE_v10011510mg [Citrus clementina] Length = 513 Score = 60.8 bits (146), Expect = 2e-07 Identities = 25/44 (56%), Positives = 32/44 (72%) Frame = -3 Query: 406 FKWIVPIFCWRRKGRRARYMFGLSANNIGLLVLLDRSPRVGLWR 275 FKWI WRRK R++Y GL+ANN+GLL+LLD+ PR+ WR Sbjct: 463 FKWIASFVFWRRKAHRSKYACGLTANNVGLLMLLDKDPRMRKWR 506 >ref|XP_002884869.1| hypothetical protein ARALYDRAFT_478531 [Arabidopsis lyrata subsp. lyrata] gi|297330709|gb|EFH61128.1| hypothetical protein ARALYDRAFT_478531 [Arabidopsis lyrata subsp. lyrata] Length = 500 Score = 60.8 bits (146), Expect = 2e-07 Identities = 25/44 (56%), Positives = 32/44 (72%) Frame = -3 Query: 406 FKWIVPIFCWRRKGRRARYMFGLSANNIGLLVLLDRSPRVGLWR 275 FKWI W+RK RR++YMFG+S NNIGL +LL++ PR WR Sbjct: 450 FKWITSFVSWKRKARRSKYMFGMSGNNIGLQMLLEKVPRSRKWR 493 >ref|XP_004494287.1| PREDICTED: uncharacterized protein LOC101514115 [Cicer arietinum] Length = 467 Score = 60.1 bits (144), Expect = 3e-07 Identities = 24/45 (53%), Positives = 33/45 (73%) Frame = -3 Query: 406 FKWIVPIFCWRRKGRRARYMFGLSANNIGLLVLLDRSPRVGLWRH 272 FKW+ I WR++G + +YMFGL +NN GLL+LLD+ P V WR+ Sbjct: 417 FKWVASIVFWRKRGHQIKYMFGLPSNNNGLLMLLDKGPGVRSWRY 461 >ref|NP_187791.1| uncharacterized protein [Arabidopsis thaliana] gi|42572387|ref|NP_974289.1| uncharacterized protein [Arabidopsis thaliana] gi|6671941|gb|AAF23201.1|AC016795_14 hypothetical protein [Arabidopsis thaliana] gi|20466598|gb|AAM20616.1| unknown protein [Arabidopsis thaliana] gi|22136430|gb|AAM91293.1| unknown protein [Arabidopsis thaliana] gi|332641587|gb|AEE75108.1| uncharacterized protein AT3G11850 [Arabidopsis thaliana] gi|332641588|gb|AEE75109.1| uncharacterized protein AT3G11850 [Arabidopsis thaliana] Length = 504 Score = 59.7 bits (143), Expect = 4e-07 Identities = 24/44 (54%), Positives = 32/44 (72%) Frame = -3 Query: 406 FKWIVPIFCWRRKGRRARYMFGLSANNIGLLVLLDRSPRVGLWR 275 FKWI W+RK RR++YM+G+S NNIGL +LL++ PR WR Sbjct: 454 FKWITSFVSWKRKARRSKYMYGMSGNNIGLQMLLEKVPRSRKWR 497 >gb|EMT23778.1| hypothetical protein F775_12620 [Aegilops tauschii] Length = 294 Score = 58.9 bits (141), Expect = 7e-07 Identities = 23/41 (56%), Positives = 34/41 (82%), Gaps = 1/41 (2%) Frame = -3 Query: 406 FKWIVPIFC-WRRKGRRARYMFGLSANNIGLLVLLDRSPRV 287 FKW + +FC W++K ++RY FGLS+NN+GLL+LLD+ PR+ Sbjct: 246 FKWAIALFCSWKKKPSQSRYTFGLSSNNVGLLILLDKCPRI 286 >ref|XP_004249385.1| PREDICTED: uncharacterized protein LOC101267280 [Solanum lycopersicum] Length = 516 Score = 58.9 bits (141), Expect = 7e-07 Identities = 26/44 (59%), Positives = 29/44 (65%) Frame = -3 Query: 406 FKWIVPIFCWRRKGRRARYMFGLSANNIGLLVLLDRSPRVGLWR 275 FKWI WRRK RR +Y FG S NN GLL+LLD+ P V WR Sbjct: 466 FKWITCFVLWRRKARRCKYPFGSSTNNPGLLMLLDKGPHVEQWR 509 >ref|NP_196274.1| uncharacterized protein [Arabidopsis thaliana] gi|13430752|gb|AAK25998.1|AF360288_1 unknown protein [Arabidopsis thaliana] gi|10178112|dbj|BAB11405.1| unnamed protein product [Arabidopsis thaliana] gi|15293221|gb|AAK93721.1| unknown protein [Arabidopsis thaliana] gi|332003651|gb|AED91034.1| uncharacterized protein AT5G06560 [Arabidopsis thaliana] Length = 518 Score = 58.2 bits (139), Expect = 1e-06 Identities = 23/44 (52%), Positives = 32/44 (72%) Frame = -3 Query: 406 FKWIVPIFCWRRKGRRARYMFGLSANNIGLLVLLDRSPRVGLWR 275 FKWI WRRK RR++YM G+ NN+GL +LL+++PR+ WR Sbjct: 468 FKWITSFVFWRRKARRSKYMNGVQGNNMGLQMLLEKTPRIRQWR 511