BLASTX nr result
ID: Mentha29_contig00036110
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00036110 (347 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU31145.1| hypothetical protein MIMGU_mgv1a020597mg, partial... 56 6e-06 >gb|EYU31145.1| hypothetical protein MIMGU_mgv1a020597mg, partial [Mimulus guttatus] Length = 1336 Score = 55.8 bits (133), Expect = 6e-06 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = +1 Query: 250 MENIETLLAAVAQTQGFDDDERVASTASKLG 342 MENIETLLAAVAQTQGFDDDE VASTA +LG Sbjct: 1 MENIETLLAAVAQTQGFDDDEPVASTAPELG 31