BLASTX nr result
ID: Mentha29_contig00035285
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00035285 (395 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU42901.1| hypothetical protein MIMGU_mgv1a023372mg [Mimulus... 60 1e-08 >gb|EYU42901.1| hypothetical protein MIMGU_mgv1a023372mg [Mimulus guttatus] Length = 111 Score = 59.7 bits (143), Expect(2) = 1e-08 Identities = 26/42 (61%), Positives = 31/42 (73%) Frame = -3 Query: 219 PVIHVKVANVISGSTITVHCYSGDNDLGYHKLAILEPLSWSF 94 P +HV VA+VI ITVHCYS D+DLG H+LA L+P SW F Sbjct: 6 PEVHVTVASVIPADPITVHCYSKDDDLGTHQLAYLQPFSWHF 47 Score = 25.4 bits (54), Expect(2) = 1e-08 Identities = 12/24 (50%), Positives = 16/24 (66%), Gaps = 2/24 (8%) Frame = -1 Query: 86 SALGNTKFICTITTKNGS--FIMW 21 S LG+TKF C I T+ GS + +W Sbjct: 50 SILGDTKFSCKIDTQYGSGEYTVW 73