BLASTX nr result
ID: Mentha29_contig00035217
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00035217 (239 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006359375.1| PREDICTED: mitochondrial zinc maintenance pr... 56 6e-06 ref|XP_004247419.1| PREDICTED: mitochondrial zinc maintenance pr... 56 6e-06 >ref|XP_006359375.1| PREDICTED: mitochondrial zinc maintenance protein 1, mitochondrial-like [Solanum tuberosum] Length = 108 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = +3 Query: 144 FAGDTLMLRQSAAEVRKKFEENRHVTSAADL 236 FAGDT ML+QSAAEVRKKFEENRHV+S AD+ Sbjct: 24 FAGDTFMLQQSAAEVRKKFEENRHVSSEADI 54 >ref|XP_004247419.1| PREDICTED: mitochondrial zinc maintenance protein 1, mitochondrial-like [Solanum lycopersicum] Length = 108 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = +3 Query: 144 FAGDTLMLRQSAAEVRKKFEENRHVTSAADL 236 FAGDT ML+QSAAEVRKKFEENRHV+S AD+ Sbjct: 24 FAGDTFMLQQSAAEVRKKFEENRHVSSEADI 54