BLASTX nr result
ID: Mentha29_contig00035094
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00035094 (388 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU33167.1| hypothetical protein MIMGU_mgv1a001008mg [Mimulus... 70 2e-10 >gb|EYU33167.1| hypothetical protein MIMGU_mgv1a001008mg [Mimulus guttatus] Length = 914 Score = 70.5 bits (171), Expect = 2e-10 Identities = 37/75 (49%), Positives = 42/75 (56%), Gaps = 5/75 (6%) Frame = -3 Query: 212 MKRLFFFRXXXXXXXXXXXT-----DKQVSWEKPTERVDKSVKKKHASEDQEFGSTPCXX 48 MK+LFFFR DKQV WEKPTE+VDKSVK KH E+QEFGS+PC Sbjct: 1 MKKLFFFRSHSSNTVNNNQLSPPSTDKQVYWEKPTEKVDKSVKNKHGFEEQEFGSSPCLR 60 Query: 47 XXXXXXXXXLYDTGK 3 Y+TGK Sbjct: 61 RSLSFSSGSPYETGK 75