BLASTX nr result
ID: Mentha29_contig00034831
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00034831 (188 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU32212.1| hypothetical protein MIMGU_mgv1a009645mg [Mimulus... 76 6e-12 ref|XP_006476431.1| PREDICTED: CMP-sialic acid transporter 1-lik... 76 6e-12 ref|XP_006439403.1| hypothetical protein CICLE_v10021053mg [Citr... 76 6e-12 ref|XP_006339676.1| PREDICTED: CMP-sialic acid transporter 1-lik... 72 6e-11 ref|XP_007209334.1| hypothetical protein PRUPE_ppa008370mg [Prun... 71 1e-10 ref|XP_002532660.1| cmp-sialic acid transporter, putative [Ricin... 71 1e-10 ref|XP_002280548.1| PREDICTED: CMP-sialic acid transporter [Viti... 71 2e-10 emb|CAN60247.1| hypothetical protein VITISV_039397 [Vitis vinifera] 71 2e-10 ref|XP_004494800.1| PREDICTED: CMP-sialic acid transporter 1-lik... 70 2e-10 gb|EXC02948.1| CMP-sialic acid transporter 1 [Morus notabilis] 70 4e-10 ref|XP_002297987.1| nucleotide-sugar transporter family protein ... 70 4e-10 ref|XP_007147279.1| hypothetical protein PHAVU_006G110600g [Phas... 69 7e-10 ref|XP_007051622.1| Nucleotide-sugar transporter family protein ... 69 7e-10 ref|XP_004298875.1| PREDICTED: CMP-sialic acid transporter 1-lik... 69 7e-10 ref|XP_003521799.1| PREDICTED: CMP-sialic acid transporter 1-lik... 69 7e-10 ref|XP_002304546.1| nucleotide-sugar transporter family protein ... 69 7e-10 ref|XP_004231201.1| PREDICTED: CMP-sialic acid transporter 1-lik... 68 2e-09 ref|XP_003626549.1| UDP-galactose/UDP-N-acetylglucosamine transp... 68 2e-09 gb|ACJ84545.1| unknown [Medicago truncatula] gi|388506604|gb|AFK... 68 2e-09 ref|XP_006405312.1| hypothetical protein EUTSA_v10027829mg [Eutr... 63 5e-08 >gb|EYU32212.1| hypothetical protein MIMGU_mgv1a009645mg [Mimulus guttatus] Length = 335 Score = 75.9 bits (185), Expect = 6e-12 Identities = 35/44 (79%), Positives = 40/44 (90%) Frame = -3 Query: 186 LFLGIVICMMSLHMYFAPPTVLVDLPLTAKALPESVDEVSVDRR 55 LFLGI +CMMSLHMYFAPP++LVDLPLT+KA PES EVSVDR+ Sbjct: 289 LFLGIFVCMMSLHMYFAPPSMLVDLPLTSKAAPESAVEVSVDRK 332 >ref|XP_006476431.1| PREDICTED: CMP-sialic acid transporter 1-like [Citrus sinensis] Length = 335 Score = 75.9 bits (185), Expect = 6e-12 Identities = 35/45 (77%), Positives = 41/45 (91%) Frame = -3 Query: 186 LFLGIVICMMSLHMYFAPPTVLVDLPLTAKALPESVDEVSVDRRT 52 LFLGI+ICMMSLHMYFAPP +LVD+P TAKA P+S+ EVSV+RRT Sbjct: 289 LFLGIIICMMSLHMYFAPPGMLVDIPSTAKAAPDSLREVSVERRT 333 >ref|XP_006439403.1| hypothetical protein CICLE_v10021053mg [Citrus clementina] gi|557541665|gb|ESR52643.1| hypothetical protein CICLE_v10021053mg [Citrus clementina] Length = 335 Score = 75.9 bits (185), Expect = 6e-12 Identities = 35/45 (77%), Positives = 41/45 (91%) Frame = -3 Query: 186 LFLGIVICMMSLHMYFAPPTVLVDLPLTAKALPESVDEVSVDRRT 52 LFLGI+ICMMSLHMYFAPP +LVD+P TAKA P+S+ EVSV+RRT Sbjct: 289 LFLGIIICMMSLHMYFAPPGMLVDIPSTAKAAPDSLREVSVERRT 333 >ref|XP_006339676.1| PREDICTED: CMP-sialic acid transporter 1-like [Solanum tuberosum] Length = 335 Score = 72.4 bits (176), Expect = 6e-11 Identities = 33/45 (73%), Positives = 38/45 (84%) Frame = -3 Query: 186 LFLGIVICMMSLHMYFAPPTVLVDLPLTAKALPESVDEVSVDRRT 52 LFLGI+ICMMSLHMYFAPP+ LVDLPLT K + ESV EV +R+T Sbjct: 289 LFLGIIICMMSLHMYFAPPSTLVDLPLTVKPVSESVSEVPAERKT 333 >ref|XP_007209334.1| hypothetical protein PRUPE_ppa008370mg [Prunus persica] gi|462405069|gb|EMJ10533.1| hypothetical protein PRUPE_ppa008370mg [Prunus persica] Length = 335 Score = 71.2 bits (173), Expect = 1e-10 Identities = 32/45 (71%), Positives = 39/45 (86%) Frame = -3 Query: 186 LFLGIVICMMSLHMYFAPPTVLVDLPLTAKALPESVDEVSVDRRT 52 LFLGI+ICMMSLHMYFAPP +L+DLPL KA ES+ EVSV+R++ Sbjct: 289 LFLGIIICMMSLHMYFAPPNMLIDLPLPVKATTESLKEVSVERKS 333 >ref|XP_002532660.1| cmp-sialic acid transporter, putative [Ricinus communis] gi|223527620|gb|EEF29733.1| cmp-sialic acid transporter, putative [Ricinus communis] Length = 335 Score = 71.2 bits (173), Expect = 1e-10 Identities = 34/45 (75%), Positives = 39/45 (86%) Frame = -3 Query: 186 LFLGIVICMMSLHMYFAPPTVLVDLPLTAKALPESVDEVSVDRRT 52 LFLGI+ICMMSLHMYFAPP +LVDLP KA PES+ +VSV+RRT Sbjct: 289 LFLGIIICMMSLHMYFAPPGMLVDLPSMGKADPESLIDVSVERRT 333 >ref|XP_002280548.1| PREDICTED: CMP-sialic acid transporter [Vitis vinifera] gi|297745398|emb|CBI40478.3| unnamed protein product [Vitis vinifera] Length = 331 Score = 70.9 bits (172), Expect = 2e-10 Identities = 35/45 (77%), Positives = 38/45 (84%) Frame = -3 Query: 186 LFLGIVICMMSLHMYFAPPTVLVDLPLTAKALPESVDEVSVDRRT 52 LFLGIVICMMSLHMYFAPPT+LVDLPLT K+ PES +DRRT Sbjct: 289 LFLGIVICMMSLHMYFAPPTMLVDLPLTVKSAPES----HIDRRT 329 >emb|CAN60247.1| hypothetical protein VITISV_039397 [Vitis vinifera] Length = 392 Score = 70.9 bits (172), Expect = 2e-10 Identities = 35/45 (77%), Positives = 38/45 (84%) Frame = -3 Query: 186 LFLGIVICMMSLHMYFAPPTVLVDLPLTAKALPESVDEVSVDRRT 52 LFLGIVICMMSLHMYFAPPT+LVDLPLT K+ PES +DRRT Sbjct: 350 LFLGIVICMMSLHMYFAPPTMLVDLPLTVKSAPES----HIDRRT 390 >ref|XP_004494800.1| PREDICTED: CMP-sialic acid transporter 1-like isoform X1 [Cicer arietinum] gi|502113915|ref|XP_004494801.1| PREDICTED: CMP-sialic acid transporter 1-like isoform X2 [Cicer arietinum] gi|502113918|ref|XP_004494802.1| PREDICTED: CMP-sialic acid transporter 1-like isoform X3 [Cicer arietinum] Length = 335 Score = 70.5 bits (171), Expect = 2e-10 Identities = 33/44 (75%), Positives = 38/44 (86%) Frame = -3 Query: 186 LFLGIVICMMSLHMYFAPPTVLVDLPLTAKALPESVDEVSVDRR 55 LFLGI+ICMMSLHMYFAPP VL+D+PLT K+ E + EVSVDRR Sbjct: 289 LFLGIIICMMSLHMYFAPPNVLLDMPLTVKSDEERLIEVSVDRR 332 >gb|EXC02948.1| CMP-sialic acid transporter 1 [Morus notabilis] Length = 335 Score = 69.7 bits (169), Expect = 4e-10 Identities = 33/45 (73%), Positives = 39/45 (86%) Frame = -3 Query: 186 LFLGIVICMMSLHMYFAPPTVLVDLPLTAKALPESVDEVSVDRRT 52 LFLGI+ICMMSLHMYFAP +LVD+ +TAKA ES+ EVSVDRR+ Sbjct: 289 LFLGIIICMMSLHMYFAPRNMLVDISVTAKAASESLKEVSVDRRS 333 >ref|XP_002297987.1| nucleotide-sugar transporter family protein [Populus trichocarpa] gi|222845245|gb|EEE82792.1| nucleotide-sugar transporter family protein [Populus trichocarpa] Length = 335 Score = 69.7 bits (169), Expect = 4e-10 Identities = 31/45 (68%), Positives = 38/45 (84%) Frame = -3 Query: 186 LFLGIVICMMSLHMYFAPPTVLVDLPLTAKALPESVDEVSVDRRT 52 LF GI+ICMMSLHMYFAPP +L+DLP +A PES+ EV+V+RRT Sbjct: 289 LFSGIIICMMSLHMYFAPPNMLLDLPTQVRAAPESLKEVTVERRT 333 >ref|XP_007147279.1| hypothetical protein PHAVU_006G110600g [Phaseolus vulgaris] gi|561020502|gb|ESW19273.1| hypothetical protein PHAVU_006G110600g [Phaseolus vulgaris] Length = 335 Score = 68.9 bits (167), Expect = 7e-10 Identities = 32/44 (72%), Positives = 37/44 (84%) Frame = -3 Query: 186 LFLGIVICMMSLHMYFAPPTVLVDLPLTAKALPESVDEVSVDRR 55 LFLGI+ICMMSLHMYFAPP +L+D+PLT K E + EVSVDRR Sbjct: 289 LFLGIIICMMSLHMYFAPPNMLLDMPLTVKPDEEKLIEVSVDRR 332 >ref|XP_007051622.1| Nucleotide-sugar transporter family protein [Theobroma cacao] gi|508703883|gb|EOX95779.1| Nucleotide-sugar transporter family protein [Theobroma cacao] Length = 335 Score = 68.9 bits (167), Expect = 7e-10 Identities = 31/45 (68%), Positives = 37/45 (82%) Frame = -3 Query: 186 LFLGIVICMMSLHMYFAPPTVLVDLPLTAKALPESVDEVSVDRRT 52 LFLGI++CMMSLHMYFAPP +LVDLP T + PES+ V VDR+T Sbjct: 289 LFLGIIVCMMSLHMYFAPPNMLVDLPSTVRTDPESLVNVPVDRKT 333 >ref|XP_004298875.1| PREDICTED: CMP-sialic acid transporter 1-like [Fragaria vesca subsp. vesca] Length = 331 Score = 68.9 bits (167), Expect = 7e-10 Identities = 32/41 (78%), Positives = 35/41 (85%) Frame = -3 Query: 186 LFLGIVICMMSLHMYFAPPTVLVDLPLTAKALPESVDEVSV 64 LFLGI+ICMMSLHMYFAPP LVDLPL KA PES+ EV+V Sbjct: 289 LFLGIIICMMSLHMYFAPPNTLVDLPLPIKATPESMKEVAV 329 >ref|XP_003521799.1| PREDICTED: CMP-sialic acid transporter 1-like isoform X1 [Glycine max] gi|571447274|ref|XP_006577340.1| PREDICTED: CMP-sialic acid transporter 1-like isoform X2 [Glycine max] gi|571447276|ref|XP_006577341.1| PREDICTED: CMP-sialic acid transporter 1-like isoform X3 [Glycine max] Length = 335 Score = 68.9 bits (167), Expect = 7e-10 Identities = 32/45 (71%), Positives = 37/45 (82%) Frame = -3 Query: 186 LFLGIVICMMSLHMYFAPPTVLVDLPLTAKALPESVDEVSVDRRT 52 LFLGI+ICMMSLHMYFAPP +L+D PLT K E + EVS+DRRT Sbjct: 289 LFLGIIICMMSLHMYFAPPNLLLDKPLTVKLDEEKLIEVSIDRRT 333 >ref|XP_002304546.1| nucleotide-sugar transporter family protein [Populus trichocarpa] gi|222841978|gb|EEE79525.1| nucleotide-sugar transporter family protein [Populus trichocarpa] Length = 335 Score = 68.9 bits (167), Expect = 7e-10 Identities = 31/45 (68%), Positives = 37/45 (82%) Frame = -3 Query: 186 LFLGIVICMMSLHMYFAPPTVLVDLPLTAKALPESVDEVSVDRRT 52 L LG +ICMMSLHMYFAPP +LVDLP +A PES+ EV+V+RRT Sbjct: 289 LLLGTIICMMSLHMYFAPPNMLVDLPTQVRAAPESLKEVAVERRT 333 >ref|XP_004231201.1| PREDICTED: CMP-sialic acid transporter 1-like [Solanum lycopersicum] Length = 340 Score = 67.8 bits (164), Expect = 2e-09 Identities = 31/42 (73%), Positives = 35/42 (83%) Frame = -3 Query: 186 LFLGIVICMMSLHMYFAPPTVLVDLPLTAKALPESVDEVSVD 61 LFLGI+ICMMSLHMYFAPP+ LVDLPLT K + ESV EV + Sbjct: 299 LFLGIIICMMSLHMYFAPPSTLVDLPLTVKPVSESVSEVPAE 340 >ref|XP_003626549.1| UDP-galactose/UDP-N-acetylglucosamine transporter srf-3 [Medicago truncatula] gi|355501564|gb|AES82767.1| UDP-galactose/UDP-N-acetylglucosamine transporter srf-3 [Medicago truncatula] Length = 409 Score = 67.8 bits (164), Expect = 2e-09 Identities = 34/46 (73%), Positives = 39/46 (84%), Gaps = 1/46 (2%) Frame = -3 Query: 186 LFLGIVICMMSLHMYFAPPTVLVDLPLTAKA-LPESVDEVSVDRRT 52 LFLGIVICMMSLHMYFAPP +L+D+PLT K+ E + EVSVDRRT Sbjct: 362 LFLGIVICMMSLHMYFAPPNMLLDMPLTVKSDEEEKLIEVSVDRRT 407 >gb|ACJ84545.1| unknown [Medicago truncatula] gi|388506604|gb|AFK41368.1| unknown [Medicago truncatula] Length = 336 Score = 67.8 bits (164), Expect = 2e-09 Identities = 34/46 (73%), Positives = 39/46 (84%), Gaps = 1/46 (2%) Frame = -3 Query: 186 LFLGIVICMMSLHMYFAPPTVLVDLPLTAKA-LPESVDEVSVDRRT 52 LFLGIVICMMSLHMYFAPP +L+D+PLT K+ E + EVSVDRRT Sbjct: 289 LFLGIVICMMSLHMYFAPPNMLLDMPLTVKSGEEEKLIEVSVDRRT 334 >ref|XP_006405312.1| hypothetical protein EUTSA_v10027829mg [Eutrema salsugineum] gi|557106450|gb|ESQ46765.1| hypothetical protein EUTSA_v10027829mg [Eutrema salsugineum] Length = 339 Score = 62.8 bits (151), Expect = 5e-08 Identities = 28/45 (62%), Positives = 37/45 (82%) Frame = -3 Query: 186 LFLGIVICMMSLHMYFAPPTVLVDLPLTAKALPESVDEVSVDRRT 52 LFLGI+IC+MSLHMYFAPP LVDLP+T +A P+ + +V V+ +T Sbjct: 293 LFLGIIICIMSLHMYFAPPQTLVDLPVTNEAHPKILKQVIVEEKT 337