BLASTX nr result
ID: Mentha29_contig00034744
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00034744 (311 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI22967.3| unnamed protein product [Vitis vinifera] 56 6e-06 ref|XP_002270818.1| PREDICTED: condensin-2 complex subunit H2-li... 56 6e-06 >emb|CBI22967.3| unnamed protein product [Vitis vinifera] Length = 1281 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/30 (80%), Positives = 29/30 (96%) Frame = -2 Query: 310 VRPLRELESNWTVDLARNLEEYLLKICLGQ 221 V+PLR+LESNW+VDLA+NLEEYLLKIC G+ Sbjct: 567 VQPLRDLESNWSVDLAKNLEEYLLKICSGE 596 >ref|XP_002270818.1| PREDICTED: condensin-2 complex subunit H2-like [Vitis vinifera] Length = 666 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/30 (80%), Positives = 29/30 (96%) Frame = -2 Query: 310 VRPLRELESNWTVDLARNLEEYLLKICLGQ 221 V+PLR+LESNW+VDLA+NLEEYLLKIC G+ Sbjct: 22 VQPLRDLESNWSVDLAKNLEEYLLKICSGE 51