BLASTX nr result
ID: Mentha29_contig00034611
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00034611 (259 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU22129.1| hypothetical protein MIMGU_mgv1a022290mg [Mimulus... 46 3e-09 gb|EYU22126.1| hypothetical protein MIMGU_mgv1a027129mg [Mimulus... 44 5e-06 >gb|EYU22129.1| hypothetical protein MIMGU_mgv1a022290mg [Mimulus guttatus] Length = 710 Score = 45.8 bits (107), Expect(2) = 3e-09 Identities = 25/42 (59%), Positives = 29/42 (69%) Frame = +3 Query: 12 VITIEGNVCIHILQMRSFNDVGYLLAEQVSSAVIMLPLFLTL 137 VITI GNVCIHI+Q R F V +LAE+V S + ML L L L Sbjct: 109 VITITGNVCIHIVQTRHFLFVRDILAEEVGSTLAMLLLLLIL 150 Score = 40.8 bits (94), Expect(2) = 3e-09 Identities = 17/40 (42%), Positives = 32/40 (80%), Gaps = 3/40 (7%) Frame = +1 Query: 145 AMMVPSARRYMELKYDKMHKRV---SNREIEWGKFTLDEV 255 A+MVP+A+RY++L +M +RV +N+++EWG+F++ E+ Sbjct: 154 AVMVPTAKRYIDLACREMRRRVVISNNKKVEWGEFSVGEL 193 >gb|EYU22126.1| hypothetical protein MIMGU_mgv1a027129mg [Mimulus guttatus] Length = 804 Score = 43.9 bits (102), Expect(2) = 5e-06 Identities = 22/46 (47%), Positives = 30/46 (65%) Frame = +3 Query: 6 LQVITIEGNVCIHILQMRSFNDVGYLLAEQVSSAVIMLPLFLTLFF 143 L V+T+ GNV +HI+ + F DV ++ EQ+ AV ML L LTL F Sbjct: 126 LLVLTVFGNVAVHIMHLLHFYDVHSIMEEQIVCAVFMLFLLLTLCF 171 Score = 32.0 bits (71), Expect(2) = 5e-06 Identities = 13/38 (34%), Positives = 27/38 (71%), Gaps = 1/38 (2%) Frame = +1 Query: 145 AMMVPSARRYMELKYDKMHKRVSN-REIEWGKFTLDEV 255 A+M+P+A+R + L Y + +++SN +++ WG F+ E+ Sbjct: 173 AVMLPTAKRQIHLAYCETRRKISNDKKVVWGNFSDGEL 210