BLASTX nr result
ID: Mentha29_contig00034541
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00034541 (297 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU26239.1| hypothetical protein MIMGU_mgv1a020677mg [Mimulus... 71 1e-10 ref|XP_007134039.1| hypothetical protein PHAVU_010G014300g [Phas... 55 8e-06 >gb|EYU26239.1| hypothetical protein MIMGU_mgv1a020677mg [Mimulus guttatus] Length = 454 Score = 71.2 bits (173), Expect = 1e-10 Identities = 33/51 (64%), Positives = 39/51 (76%), Gaps = 1/51 (1%) Frame = +3 Query: 3 WGKPVWASIIGVPM-KNLIFFLGTKSGDGIEAWVSMXXXXXXXXXTNYHVL 152 WGKPVW SIIGVP KNLIFF+G+KSGDGIEAW++M TNY++L Sbjct: 400 WGKPVWVSIIGVPTRKNLIFFMGSKSGDGIEAWLNMAQEDADVIQTNYNLL 450 >ref|XP_007134039.1| hypothetical protein PHAVU_010G014300g [Phaseolus vulgaris] gi|561007084|gb|ESW06033.1| hypothetical protein PHAVU_010G014300g [Phaseolus vulgaris] Length = 432 Score = 55.5 bits (132), Expect = 8e-06 Identities = 22/35 (62%), Positives = 29/35 (82%) Frame = +3 Query: 3 WGKPVWASIIGVPMKNLIFFLGTKSGDGIEAWVSM 107 WGKP + S IGVP+KN++ F+ TK GDGIEAW+S+ Sbjct: 375 WGKPSYVSRIGVPIKNVVSFMPTKGGDGIEAWISL 409