BLASTX nr result
ID: Mentha29_contig00034487
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00034487 (250 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007207055.1| hypothetical protein PRUPE_ppb002198mg [Prun... 57 2e-06 ref|XP_003628782.1| Pentatricopeptide repeat-containing protein ... 57 3e-06 >ref|XP_007207055.1| hypothetical protein PRUPE_ppb002198mg [Prunus persica] gi|462402697|gb|EMJ08254.1| hypothetical protein PRUPE_ppb002198mg [Prunus persica] Length = 636 Score = 57.4 bits (137), Expect = 2e-06 Identities = 27/47 (57%), Positives = 32/47 (68%) Frame = -1 Query: 148 QGRMKEGGVGKIPGPSWIESGGEVQEFVSSDKSHVEGERVYRTLDEL 8 + RM E G+ KIPG SWIE G VQEF+ DKSH E++Y LDEL Sbjct: 490 RSRMNEQGMKKIPGCSWIEVNGVVQEFLVGDKSHALSEKIYAKLDEL 536 >ref|XP_003628782.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355522804|gb|AET03258.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 1002 Score = 57.0 bits (136), Expect = 3e-06 Identities = 27/47 (57%), Positives = 34/47 (72%) Frame = -1 Query: 148 QGRMKEGGVGKIPGPSWIESGGEVQEFVSSDKSHVEGERVYRTLDEL 8 +G MKE G+ KIPG SWIE G E+ F++SDKSH E E +Y+ LD L Sbjct: 814 RGFMKEKGLKKIPGCSWIEVGQELNVFIASDKSHPEKEEIYKILDLL 860