BLASTX nr result
ID: Mentha29_contig00034452
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00034452 (285 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU26132.1| hypothetical protein MIMGU_mgv1a002830mg [Mimulus... 105 5e-21 gb|EPS70033.1| hypothetical protein M569_04727 [Genlisea aurea] 94 3e-17 ref|XP_004306013.1| PREDICTED: pentatricopeptide repeat-containi... 75 7e-12 ref|XP_006306944.1| hypothetical protein CARUB_v10008524mg [Caps... 74 2e-11 ref|XP_002892169.1| pentatricopeptide repeat-containing protein ... 73 4e-11 ref|NP_171855.1| pentatricopeptide repeat-containing protein [Ar... 71 2e-10 dbj|BAF01006.1| hypothetical protein [Arabidopsis thaliana] 71 2e-10 ref|XP_006447324.1| hypothetical protein CICLE_v10014552mg [Citr... 69 7e-10 ref|XP_006418224.1| hypothetical protein EUTSA_v10007014mg [Eutr... 69 7e-10 ref|XP_006371589.1| pentatricopeptide repeat-containing family p... 69 9e-10 ref|XP_004248470.1| PREDICTED: pentatricopeptide repeat-containi... 68 1e-09 ref|XP_006366006.1| PREDICTED: pentatricopeptide repeat-containi... 68 1e-09 ref|XP_004155527.1| PREDICTED: pentatricopeptide repeat-containi... 66 4e-09 ref|XP_004137016.1| PREDICTED: pentatricopeptide repeat-containi... 66 4e-09 ref|XP_002532772.1| pentatricopeptide repeat-containing protein,... 66 4e-09 ref|XP_007216986.1| hypothetical protein PRUPE_ppa002596mg [Prun... 65 7e-09 ref|XP_006850819.1| hypothetical protein AMTR_s00025p00124790 [A... 64 2e-08 ref|XP_004513160.1| PREDICTED: pentatricopeptide repeat-containi... 64 2e-08 emb|CBI28908.3| unnamed protein product [Vitis vinifera] 64 2e-08 ref|XP_007028826.1| Pentatricopeptide repeat (PPR-like) superfam... 62 8e-08 >gb|EYU26132.1| hypothetical protein MIMGU_mgv1a002830mg [Mimulus guttatus] Length = 633 Score = 105 bits (263), Expect = 5e-21 Identities = 53/92 (57%), Positives = 66/92 (71%), Gaps = 1/92 (1%) Frame = +3 Query: 3 NATPVISSRKHSSIKFASSFTS-LPPPEWVQPFTDLSDVISAEANSNRQISPWVPKVQQF 179 +A P R++SS +SSFT LPPPEWVQP DLSD+IS++ + + SPWVPK+ F Sbjct: 11 SAIPTFLKREYSSS--SSSFTPPLPPPEWVQPLNDLSDLISSDPKPDLKPSPWVPKILHF 68 Query: 180 LQSNINNFEQDLTLFCDKYLIRLPPTFTAHIL 275 LQ+ EQDLTLFC KYLI+LPPTF A+IL Sbjct: 69 LQTTTTTLEQDLTLFCKKYLIKLPPTFVAYIL 100 >gb|EPS70033.1| hypothetical protein M569_04727 [Genlisea aurea] Length = 634 Score = 93.6 bits (231), Expect = 3e-17 Identities = 48/95 (50%), Positives = 62/95 (65%), Gaps = 5/95 (5%) Frame = +3 Query: 12 PVISSRKHSSIKFASSFTSLPPPEWVQPFTDLSDVI-----SAEANSNRQISPWVPKVQQ 176 P R H+ SF ++PPPEWVQPFTDLS++I AE + ++SPWVPK+ Sbjct: 17 PFTRHRGHTRKPDYRSFAAVPPPEWVQPFTDLSELIVPPPPDAEPTAALRLSPWVPKILA 76 Query: 177 FLQSNINNFEQDLTLFCDKYLIRLPPTFTAHILTN 281 L+S EQDLTLFC KYLIRLPP+F +++L N Sbjct: 77 VLRSGA--VEQDLTLFCRKYLIRLPPSFVSYVLKN 109 >ref|XP_004306013.1| PREDICTED: pentatricopeptide repeat-containing protein At1g03560, mitochondrial-like [Fragaria vesca subsp. vesca] Length = 656 Score = 75.5 bits (184), Expect = 7e-12 Identities = 36/85 (42%), Positives = 54/85 (63%) Frame = +3 Query: 21 SSRKHSSIKFASSFTSLPPPEWVQPFTDLSDVISAEANSNRQISPWVPKVQQFLQSNINN 200 +S S+ ++ + SLPPPEWV+PF D+SDVIS+ + SPWVP++ L +N Sbjct: 42 TSTSASNSRWVAVTNSLPPPEWVEPFHDVSDVISSPHRFDP--SPWVPQILNLLDNNSPQ 99 Query: 201 FEQDLTLFCDKYLIRLPPTFTAHIL 275 E +L +C K+LI+L P F A++L Sbjct: 100 MEHNLDSYCRKFLIKLSPNFVAYVL 124 >ref|XP_006306944.1| hypothetical protein CARUB_v10008524mg [Capsella rubella] gi|482575655|gb|EOA39842.1| hypothetical protein CARUB_v10008524mg [Capsella rubella] Length = 663 Score = 73.9 bits (180), Expect = 2e-11 Identities = 37/90 (41%), Positives = 60/90 (66%) Frame = +3 Query: 12 PVISSRKHSSIKFASSFTSLPPPEWVQPFTDLSDVISAEANSNRQISPWVPKVQQFLQSN 191 P+ SSR +S+++ + SLPPPEWV+PF D+SD++ ++N N Q SPWV ++ L + Sbjct: 42 PLSSSR--TSVRWVFNSISLPPPEWVEPFNDVSDLV--KSNRNLQPSPWVSQILNLLDGS 97 Query: 192 INNFEQDLTLFCDKYLIRLPPTFTAHILTN 281 ++ E +L FC K+LI+L P F + +L + Sbjct: 98 -DSMESNLDGFCRKFLIKLSPNFVSFVLNS 126 >ref|XP_002892169.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297338011|gb|EFH68428.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 662 Score = 73.2 bits (178), Expect = 4e-11 Identities = 36/88 (40%), Positives = 59/88 (67%) Frame = +3 Query: 12 PVISSRKHSSIKFASSFTSLPPPEWVQPFTDLSDVISAEANSNRQISPWVPKVQQFLQSN 191 P+ SSR +S+++ + +SLPPPEW++PF D+SD++ ++N N Q SPWV ++ L + Sbjct: 41 PLSSSR--TSVRWVFNSSSLPPPEWIEPFNDVSDLV--KSNRNLQPSPWVSQILNLLDGS 96 Query: 192 INNFEQDLTLFCDKYLIRLPPTFTAHIL 275 + E +L FC K+LI+L P F + +L Sbjct: 97 A-SMESNLDGFCRKFLIKLSPNFVSFVL 123 >ref|NP_171855.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75180297|sp|Q9LR67.1|PPR9_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At1g03560, mitochondrial; Flags: Precursor gi|9280662|gb|AAF86531.1|AC002560_24 F21B7.18 [Arabidopsis thaliana] gi|332189465|gb|AEE27586.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 660 Score = 70.9 bits (172), Expect = 2e-10 Identities = 35/89 (39%), Positives = 59/89 (66%) Frame = +3 Query: 9 TPVISSRKHSSIKFASSFTSLPPPEWVQPFTDLSDVISAEANSNRQISPWVPKVQQFLQS 188 +P+ SSR +S+++ + +SLPPPEW++PF D+SD++ ++N N SPWV ++ L Sbjct: 40 SPLSSSR--TSVRWVFNSSSLPPPEWIEPFNDVSDLV--KSNRNLLPSPWVSQILNLLDG 95 Query: 189 NINNFEQDLTLFCDKYLIRLPPTFTAHIL 275 + + E +L FC K+LI+L P F + +L Sbjct: 96 SA-SMESNLDGFCRKFLIKLSPNFVSFVL 123 >dbj|BAF01006.1| hypothetical protein [Arabidopsis thaliana] Length = 642 Score = 70.9 bits (172), Expect = 2e-10 Identities = 35/89 (39%), Positives = 59/89 (66%) Frame = +3 Query: 9 TPVISSRKHSSIKFASSFTSLPPPEWVQPFTDLSDVISAEANSNRQISPWVPKVQQFLQS 188 +P+ SSR +S+++ + +SLPPPEW++PF D+SD++ ++N N SPWV ++ L Sbjct: 22 SPLSSSR--TSVRWVFNSSSLPPPEWIEPFNDVSDLV--KSNRNLLPSPWVSQILNLLDG 77 Query: 189 NINNFEQDLTLFCDKYLIRLPPTFTAHIL 275 + + E +L FC K+LI+L P F + +L Sbjct: 78 SA-SMESNLDGFCRKFLIKLSPNFVSFVL 105 >ref|XP_006447324.1| hypothetical protein CICLE_v10014552mg [Citrus clementina] gi|568877202|ref|XP_006491635.1| PREDICTED: pentatricopeptide repeat-containing protein At1g03560, mitochondrial-like [Citrus sinensis] gi|557549935|gb|ESR60564.1| hypothetical protein CICLE_v10014552mg [Citrus clementina] Length = 650 Score = 68.9 bits (167), Expect = 7e-10 Identities = 35/82 (42%), Positives = 49/82 (59%) Frame = +3 Query: 36 SSIKFASSFTSLPPPEWVQPFTDLSDVISAEANSNRQISPWVPKVQQFLQSNINNFEQDL 215 S I S S PPPEWV+PF D+SD++S N N SPWV ++ L + ++ E +L Sbjct: 42 SFISNPRSANSFPPPEWVEPFNDVSDLVSCPQNLNP--SPWVRQILNLLDGS-SDMEANL 98 Query: 216 TLFCDKYLIRLPPTFTAHILTN 281 FC K+LI+L P F + +L N Sbjct: 99 DSFCRKFLIKLSPNFVSFVLRN 120 >ref|XP_006418224.1| hypothetical protein EUTSA_v10007014mg [Eutrema salsugineum] gi|557095995|gb|ESQ36577.1| hypothetical protein EUTSA_v10007014mg [Eutrema salsugineum] Length = 661 Score = 68.9 bits (167), Expect = 7e-10 Identities = 32/78 (41%), Positives = 51/78 (65%) Frame = +3 Query: 42 IKFASSFTSLPPPEWVQPFTDLSDVISAEANSNRQISPWVPKVQQFLQSNINNFEQDLTL 221 ++ S +SLPPPEW++PF D+SD++ ++ N Q SPWV ++ L + ++ E +L Sbjct: 49 VRCVFSSSSLPPPEWIEPFNDVSDLV--KSTGNLQPSPWVSQILNLLDGS-DSMESNLDG 105 Query: 222 FCDKYLIRLPPTFTAHIL 275 FC K+LI+L P F A +L Sbjct: 106 FCRKFLIKLSPNFVAFVL 123 >ref|XP_006371589.1| pentatricopeptide repeat-containing family protein [Populus trichocarpa] gi|550317468|gb|ERP49386.1| pentatricopeptide repeat-containing family protein [Populus trichocarpa] Length = 659 Score = 68.6 bits (166), Expect = 9e-10 Identities = 37/96 (38%), Positives = 51/96 (53%), Gaps = 11/96 (11%) Frame = +3 Query: 21 SSRKHSSIKFASSFTS-----------LPPPEWVQPFTDLSDVISAEANSNRQISPWVPK 167 SS KH + +FTS LPPPEW++PF DLSD+ S + SPWV + Sbjct: 33 SSSKHPKKRPTLTFTSNSRWVFTDSNYLPPPEWIEPFNDLSDIASKPPQDLKP-SPWVHQ 91 Query: 168 VQQFLQSNINNFEQDLTLFCDKYLIRLPPTFTAHIL 275 + L + E L LFC+K+LI+L P F + +L Sbjct: 92 IMSLLLDGPVDMESRLDLFCNKFLIKLSPNFVSFVL 127 >ref|XP_004248470.1| PREDICTED: pentatricopeptide repeat-containing protein At1g03560, mitochondrial-like [Solanum lycopersicum] Length = 711 Score = 68.2 bits (165), Expect = 1e-09 Identities = 34/80 (42%), Positives = 53/80 (66%) Frame = +3 Query: 36 SSIKFASSFTSLPPPEWVQPFTDLSDVISAEANSNRQISPWVPKVQQFLQSNINNFEQDL 215 S K+ + ++LPPPEWVQPF DLSD+++ + + SPWV ++ L N EQ+L Sbjct: 103 SKPKWVFTGSNLPPPEWVQPFVDLSDLVT--DRKDLKPSPWVSQILNLL-DNSPLMEQNL 159 Query: 216 TLFCDKYLIRLPPTFTAHIL 275 ++C K+LI+L P+F A++L Sbjct: 160 DVYCCKFLIKLSPSFVAYVL 179 >ref|XP_006366006.1| PREDICTED: pentatricopeptide repeat-containing protein At1g03560, mitochondrial-like isoform X1 [Solanum tuberosum] gi|565401005|ref|XP_006366007.1| PREDICTED: pentatricopeptide repeat-containing protein At1g03560, mitochondrial-like isoform X2 [Solanum tuberosum] gi|565401007|ref|XP_006366008.1| PREDICTED: pentatricopeptide repeat-containing protein At1g03560, mitochondrial-like isoform X3 [Solanum tuberosum] gi|565401009|ref|XP_006366009.1| PREDICTED: pentatricopeptide repeat-containing protein At1g03560, mitochondrial-like isoform X4 [Solanum tuberosum] gi|565401011|ref|XP_006366010.1| PREDICTED: pentatricopeptide repeat-containing protein At1g03560, mitochondrial-like isoform X5 [Solanum tuberosum] Length = 711 Score = 67.8 bits (164), Expect = 1e-09 Identities = 34/80 (42%), Positives = 53/80 (66%) Frame = +3 Query: 36 SSIKFASSFTSLPPPEWVQPFTDLSDVISAEANSNRQISPWVPKVQQFLQSNINNFEQDL 215 S K+ + ++LPPPEWVQPF DLSD+++ + + SPWV ++ L N EQ+L Sbjct: 103 SKPKWVYTGSNLPPPEWVQPFIDLSDLVT--DRKDLKPSPWVSQILNLL-DNSPLMEQNL 159 Query: 216 TLFCDKYLIRLPPTFTAHIL 275 ++C K+LI+L P+F A++L Sbjct: 160 DVYCCKFLIKLSPSFVAYVL 179 >ref|XP_004155527.1| PREDICTED: pentatricopeptide repeat-containing protein At1g03560, mitochondrial-like [Cucumis sativus] Length = 653 Score = 66.2 bits (160), Expect = 4e-09 Identities = 31/79 (39%), Positives = 48/79 (60%) Frame = +3 Query: 39 SIKFASSFTSLPPPEWVQPFTDLSDVISAEANSNRQISPWVPKVQQFLQSNINNFEQDLT 218 + +F + T LPPPEW++PF D+SDVIS ++ SPWV ++ L + +N E +L Sbjct: 46 NFRFVFTNTLLPPPEWIEPFVDVSDVIS--SSQPLDPSPWVAQILNLLDGS-SNMEHNLD 102 Query: 219 LFCDKYLIRLPPTFTAHIL 275 FC K+ ++L P F +L Sbjct: 103 SFCRKFFVKLSPNFVTFVL 121 >ref|XP_004137016.1| PREDICTED: pentatricopeptide repeat-containing protein At1g03560, mitochondrial-like [Cucumis sativus] Length = 651 Score = 66.2 bits (160), Expect = 4e-09 Identities = 31/79 (39%), Positives = 48/79 (60%) Frame = +3 Query: 39 SIKFASSFTSLPPPEWVQPFTDLSDVISAEANSNRQISPWVPKVQQFLQSNINNFEQDLT 218 + +F + T LPPPEW++PF D+SDVIS ++ SPWV ++ L + +N E +L Sbjct: 44 NFRFVFTNTLLPPPEWIEPFVDVSDVIS--SSQPLDPSPWVAQILNLLDGS-SNMEHNLD 100 Query: 219 LFCDKYLIRLPPTFTAHIL 275 FC K+ ++L P F +L Sbjct: 101 SFCRKFFVKLSPNFVTFVL 119 >ref|XP_002532772.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223527482|gb|EEF29611.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 647 Score = 66.2 bits (160), Expect = 4e-09 Identities = 33/80 (41%), Positives = 50/80 (62%) Frame = +3 Query: 36 SSIKFASSFTSLPPPEWVQPFTDLSDVISAEANSNRQISPWVPKVQQFLQSNINNFEQDL 215 S+ ++ + SLPPPEW+ PF DLSDV S + + + SPWV ++ L + +N E +L Sbjct: 38 SNRRWVFTSNSLPPPEWIDPFVDLSDVAS-RTHQDLKPSPWVNQILALLDGS-SNMESNL 95 Query: 216 TLFCDKYLIRLPPTFTAHIL 275 FC +LI+L P+F + IL Sbjct: 96 DTFCHMFLIKLSPSFVSFIL 115 >ref|XP_007216986.1| hypothetical protein PRUPE_ppa002596mg [Prunus persica] gi|462413136|gb|EMJ18185.1| hypothetical protein PRUPE_ppa002596mg [Prunus persica] Length = 654 Score = 65.5 bits (158), Expect = 7e-09 Identities = 36/90 (40%), Positives = 55/90 (61%), Gaps = 5/90 (5%) Frame = +3 Query: 21 SSRKHSSIKFASS----FT-SLPPPEWVQPFTDLSDVISAEANSNRQISPWVPKVQQFLQ 185 +S HS+ F+S+ FT SLPPPEWV+PF D+SD++S + + SPWV ++ L Sbjct: 36 ASSFHSTSSFSSNPRWVFTNSLPPPEWVEPFNDVSDIVSNPQDFDP--SPWVAQILNLLD 93 Query: 186 SNINNFEQDLTLFCDKYLIRLPPTFTAHIL 275 + E +L +C +LI+L P F A++L Sbjct: 94 GS-QKMEANLDSYCHTFLIKLSPNFVAYVL 122 >ref|XP_006850819.1| hypothetical protein AMTR_s00025p00124790 [Amborella trichopoda] gi|548854490|gb|ERN12400.1| hypothetical protein AMTR_s00025p00124790 [Amborella trichopoda] Length = 682 Score = 64.3 bits (155), Expect = 2e-08 Identities = 34/77 (44%), Positives = 47/77 (61%) Frame = +3 Query: 45 KFASSFTSLPPPEWVQPFTDLSDVISAEANSNRQISPWVPKVQQFLQSNINNFEQDLTLF 224 KF TSLP EW++P+ D+SD++ E N + SPW+ KV + L + + E L F Sbjct: 58 KFRYFSTSLPAREWIEPYVDISDLV--ENPKNFKPSPWIEKVIELLDGS-PDLESRLDDF 114 Query: 225 CDKYLIRLPPTFTAHIL 275 C K+LI+L PTF HIL Sbjct: 115 CRKFLIKLSPTFVDHIL 131 >ref|XP_004513160.1| PREDICTED: pentatricopeptide repeat-containing protein At1g03560, mitochondrial-like [Cicer arietinum] Length = 649 Score = 64.3 bits (155), Expect = 2e-08 Identities = 37/88 (42%), Positives = 51/88 (57%), Gaps = 2/88 (2%) Frame = +3 Query: 18 ISSRKHSSIKFASSFTSLP--PPEWVQPFTDLSDVISAEANSNRQISPWVPKVQQFLQSN 191 + ++ S F SF SLP PPE V+P+ DLSDV+S++ N Q SPW ++ L N Sbjct: 31 LQTQSPPSHSFLRSFKSLPLPPPELVEPYCDLSDVVSSK--QNLQPSPWFTQILNLL-DN 87 Query: 192 INNFEQDLTLFCDKYLIRLPPTFTAHIL 275 E +L FC ++LI L P+F AH L Sbjct: 88 SPTMELNLNSFCQQFLITLSPSFVAHTL 115 >emb|CBI28908.3| unnamed protein product [Vitis vinifera] Length = 658 Score = 63.9 bits (154), Expect = 2e-08 Identities = 32/72 (44%), Positives = 45/72 (62%) Frame = +3 Query: 60 FTSLPPPEWVQPFTDLSDVISAEANSNRQISPWVPKVQQFLQSNINNFEQDLTLFCDKYL 239 FT+ PPEWV+P DLSD+ S N Q SPWV ++ + L ++ N E +L +C K+L Sbjct: 59 FTTPIPPEWVEPLYDLSDLAS---NPQPQPSPWVNQILKLLDGSV-NMESNLDSYCSKFL 114 Query: 240 IRLPPTFTAHIL 275 I+L P F A +L Sbjct: 115 IKLSPNFVAFVL 126 >ref|XP_007028826.1| Pentatricopeptide repeat (PPR-like) superfamily protein [Theobroma cacao] gi|508717431|gb|EOY09328.1| Pentatricopeptide repeat (PPR-like) superfamily protein [Theobroma cacao] Length = 654 Score = 62.0 bits (149), Expect = 8e-08 Identities = 34/93 (36%), Positives = 52/93 (55%) Frame = +3 Query: 3 NATPVISSRKHSSIKFASSFTSLPPPEWVQPFTDLSDVISAEANSNRQISPWVPKVQQFL 182 N +S+ S +F + + LPPPEW++PF ++S + S + Q SPWV K+ L Sbjct: 34 NPPKPLSNSISISSRFIFTPSYLPPPEWIEPFFNVSGLASTFPQ-DLQPSPWVSKIVNLL 92 Query: 183 QSNINNFEQDLTLFCDKYLIRLPPTFTAHILTN 281 +N E +L FC K+LI+L P F A +L + Sbjct: 93 DG-CSNMESNLDSFCHKFLIQLSPNFVAFVLAS 124