BLASTX nr result
ID: Mentha29_contig00034424
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00034424 (245 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU36710.1| hypothetical protein MIMGU_mgv1a024433mg [Mimulus... 62 1e-07 >gb|EYU36710.1| hypothetical protein MIMGU_mgv1a024433mg [Mimulus guttatus] Length = 235 Score = 61.6 bits (148), Expect = 1e-07 Identities = 35/52 (67%), Positives = 38/52 (73%) Frame = +1 Query: 88 MGSLKLKFSQLGLQQRPRIPTYPHTLRITCGGLRNGPRKPMWRTRVLSYEAI 243 M S KL F QLG QQ+ P + H LRITCG LRNGPRK MWRTR+LS EAI Sbjct: 1 MSSFKLDFLQLGFQQKN--PQF-HKLRITCG-LRNGPRKAMWRTRILSTEAI 48