BLASTX nr result
ID: Mentha29_contig00033816
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00033816 (370 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU18962.1| hypothetical protein MIMGU_mgv1a021336mg [Mimulus... 80 3e-13 gb|EPS68186.1| hypothetical protein M569_06592, partial [Genlise... 78 1e-12 dbj|BAJ87487.1| predicted protein [Hordeum vulgare subsp. vulgare] 75 7e-12 gb|EYU36270.1| hypothetical protein MIMGU_mgv1a007961mg [Mimulus... 75 1e-11 ref|NP_001132327.1| hypothetical protein precursor [Zea mays] gi... 73 5e-11 gb|ABI95410.1| fasciclin-like protein FLA20 [Triticum aestivum] 73 5e-11 ref|XP_004970533.1| PREDICTED: fasciclin-like arabinogalactan pr... 71 1e-10 ref|XP_004970532.1| PREDICTED: fasciclin-like arabinogalactan pr... 71 1e-10 ref|XP_002458743.1| hypothetical protein SORBIDRAFT_03g039440 [S... 71 1e-10 emb|CBI16143.3| unnamed protein product [Vitis vinifera] 71 2e-10 gb|EEE55648.1| hypothetical protein OsJ_04030 [Oryza sativa Japo... 71 2e-10 gb|EEC71769.1| hypothetical protein OsI_04379 [Oryza sativa Indi... 71 2e-10 ref|XP_002283909.1| PREDICTED: fasciclin-like arabinogalactan pr... 71 2e-10 emb|CAN72469.1| hypothetical protein VITISV_006797 [Vitis vinifera] 71 2e-10 ref|NP_001044764.1| Os01g0841100 [Oryza sativa Japonica Group] g... 71 2e-10 ref|XP_006644987.1| PREDICTED: fasciclin-like arabinogalactan pr... 70 2e-10 ref|XP_006344402.1| PREDICTED: fasciclin-like arabinogalactan pr... 70 2e-10 ref|XP_003567260.1| PREDICTED: fasciclin-like arabinogalactan pr... 70 4e-10 ref|XP_004241229.1| PREDICTED: fasciclin-like arabinogalactan pr... 69 5e-10 tpg|DAA56901.1| TPA: hypothetical protein ZEAMMB73_426702 [Zea m... 69 5e-10 >gb|EYU18962.1| hypothetical protein MIMGU_mgv1a021336mg [Mimulus guttatus] Length = 411 Score = 80.1 bits (196), Expect = 3e-13 Identities = 41/66 (62%), Positives = 53/66 (80%), Gaps = 6/66 (9%) Frame = +2 Query: 191 AYPSFSAFNSLLSSTGIAADLASRSSLTLLAVPNSFLRPTPAAN------LADVLRYHVL 352 ++P+FS F SLL++T +AADL+ RSS+T+LAVPN++LR + A N LADVLRYHVL Sbjct: 40 SHPNFSDFTSLLTTTAVAADLSGRSSITILAVPNAYLRTSSAVNRPSPAVLADVLRYHVL 99 Query: 353 LEYLSL 370 LEYLSL Sbjct: 100 LEYLSL 105 >gb|EPS68186.1| hypothetical protein M569_06592, partial [Genlisea aurea] Length = 103 Score = 77.8 bits (190), Expect = 1e-12 Identities = 41/64 (64%), Positives = 52/64 (81%), Gaps = 5/64 (7%) Frame = +2 Query: 191 AYPSFSAFNSLLSSTGIAADLASRSSLTLLAVPNSFLRPTPAA-----NLADVLRYHVLL 355 +YP+FS F++LL+ST +A DL +RSSLT+LAVP+ LRPT A+ +LADVLRYHVLL Sbjct: 31 SYPAFSQFSALLASTAVAGDLDARSSLTILAVPDVDLRPTTASPHSATDLADVLRYHVLL 90 Query: 356 EYLS 367 EYLS Sbjct: 91 EYLS 94 >dbj|BAJ87487.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 418 Score = 75.5 bits (184), Expect = 7e-12 Identities = 43/66 (65%), Positives = 51/66 (77%), Gaps = 7/66 (10%) Frame = +2 Query: 191 AYPSFSAFNSLLSSTGIAADLASRSSLTLLAVPNSFLRPTPA-------ANLADVLRYHV 349 A+PSFS F LL+S+ +AA+LA RSSLTLLAVPN+ L +PA A+LADVLRYHV Sbjct: 37 AFPSFSDFARLLASSPVAAELAGRSSLTLLAVPNANLPRSPAAFAAAAGADLADVLRYHV 96 Query: 350 LLEYLS 367 LLEYLS Sbjct: 97 LLEYLS 102 >gb|EYU36270.1| hypothetical protein MIMGU_mgv1a007961mg [Mimulus guttatus] Length = 389 Score = 74.7 bits (182), Expect = 1e-11 Identities = 39/69 (56%), Positives = 51/69 (73%), Gaps = 9/69 (13%) Frame = +2 Query: 191 AYPSFSAFNSLLSSTGIAADLASRSSLTLLAVPNSFLR---------PTPAANLADVLRY 343 +YP S FN+L ++T +AADL +R+SLTLL VPN++LR P+P NLADVLRY Sbjct: 40 SYPDLSDFNNLFTTTAVAADLTTRTSLTLLVVPNAYLRSASTSASSHPSP-TNLADVLRY 98 Query: 344 HVLLEYLSL 370 HVLLEY++L Sbjct: 99 HVLLEYITL 107 >ref|NP_001132327.1| hypothetical protein precursor [Zea mays] gi|194694090|gb|ACF81129.1| unknown [Zea mays] gi|413951980|gb|AFW84629.1| hypothetical protein ZEAMMB73_957130 [Zea mays] Length = 426 Score = 72.8 bits (177), Expect = 5e-11 Identities = 39/64 (60%), Positives = 51/64 (79%), Gaps = 5/64 (7%) Frame = +2 Query: 191 AYPSFSAFNSLLSSTGIAADLASRSSLTLLAVPNSFLRPTPA-----ANLADVLRYHVLL 355 A+P+F+ F LL+ST +A++LA RSSLTLLAVPN+ L +P+ A++ADVLRYHVLL Sbjct: 47 AFPNFADFARLLASTPVASELAGRSSLTLLAVPNANLPQSPSAFVAGADIADVLRYHVLL 106 Query: 356 EYLS 367 EYLS Sbjct: 107 EYLS 110 >gb|ABI95410.1| fasciclin-like protein FLA20 [Triticum aestivum] Length = 436 Score = 72.8 bits (177), Expect = 5e-11 Identities = 41/66 (62%), Positives = 50/66 (75%), Gaps = 7/66 (10%) Frame = +2 Query: 191 AYPSFSAFNSLLSSTGIAADLASRSSLTLLAVPNSFLRPTPA-------ANLADVLRYHV 349 A+P FS F LL+S+ +AA+LA RSSLTLLAVPN+ L +P+ A+LADVLRYHV Sbjct: 45 AFPGFSDFARLLASSPVAAELAGRSSLTLLAVPNANLPRSPSAFAAAAGADLADVLRYHV 104 Query: 350 LLEYLS 367 LLEYLS Sbjct: 105 LLEYLS 110 >ref|XP_004970533.1| PREDICTED: fasciclin-like arabinogalactan protein 4-like isoform X2 [Setaria italica] Length = 428 Score = 71.2 bits (173), Expect = 1e-10 Identities = 39/66 (59%), Positives = 50/66 (75%), Gaps = 7/66 (10%) Frame = +2 Query: 191 AYPSFSAFNSLLSSTGIAADLASRSSLTLLAVPNSFLRPTPA-------ANLADVLRYHV 349 A+P+F+ F LL+ST +A +LA RSSLTLLAVPN+ L +P+ A++ADVLRYHV Sbjct: 45 AFPNFADFARLLASTPVAGELAGRSSLTLLAVPNANLPRSPSAFAAGAGADIADVLRYHV 104 Query: 350 LLEYLS 367 LLEYLS Sbjct: 105 LLEYLS 110 >ref|XP_004970532.1| PREDICTED: fasciclin-like arabinogalactan protein 4-like isoform X1 [Setaria italica] Length = 428 Score = 71.2 bits (173), Expect = 1e-10 Identities = 39/66 (59%), Positives = 50/66 (75%), Gaps = 7/66 (10%) Frame = +2 Query: 191 AYPSFSAFNSLLSSTGIAADLASRSSLTLLAVPNSFLRPTPA-------ANLADVLRYHV 349 A+P+F+ F LL+ST +A +LA RSSLTLLAVPN+ L +P+ A++ADVLRYHV Sbjct: 45 AFPNFADFARLLASTPVAGELAGRSSLTLLAVPNANLPRSPSAFAAGAGADIADVLRYHV 104 Query: 350 LLEYLS 367 LLEYLS Sbjct: 105 LLEYLS 110 >ref|XP_002458743.1| hypothetical protein SORBIDRAFT_03g039440 [Sorghum bicolor] gi|241930718|gb|EES03863.1| hypothetical protein SORBIDRAFT_03g039440 [Sorghum bicolor] Length = 428 Score = 71.2 bits (173), Expect = 1e-10 Identities = 38/66 (57%), Positives = 50/66 (75%), Gaps = 7/66 (10%) Frame = +2 Query: 191 AYPSFSAFNSLLSSTGIAADLASRSSLTLLAVPNSFLRPTPA-------ANLADVLRYHV 349 A+P+F+ F LL+ST +A +L+ RSSLTLLAVPN+ L +P+ A++ADVLRYHV Sbjct: 44 AFPNFADFARLLASTSVAGELSGRSSLTLLAVPNANLPQSPSAFVAGAGADIADVLRYHV 103 Query: 350 LLEYLS 367 LLEYLS Sbjct: 104 LLEYLS 109 >emb|CBI16143.3| unnamed protein product [Vitis vinifera] Length = 296 Score = 70.9 bits (172), Expect = 2e-10 Identities = 38/64 (59%), Positives = 47/64 (73%), Gaps = 6/64 (9%) Frame = +2 Query: 194 YPSFSAFNSLLSSTGIAADLASRSSLTLLAVPNSFLRP------TPAANLADVLRYHVLL 355 YP S F +LL++T + DL RSSLTLLAVPNSFLR + A++LADV+RYHVLL Sbjct: 89 YPDLSDFANLLTATAVDGDLIHRSSLTLLAVPNSFLRSSDLTHRSSASSLADVIRYHVLL 148 Query: 356 EYLS 367 +YLS Sbjct: 149 QYLS 152 >gb|EEE55648.1| hypothetical protein OsJ_04030 [Oryza sativa Japonica Group] Length = 427 Score = 70.9 bits (172), Expect = 2e-10 Identities = 39/66 (59%), Positives = 50/66 (75%), Gaps = 7/66 (10%) Frame = +2 Query: 191 AYPSFSAFNSLLSSTGIAADLASRSSLTLLAVPNSFLRPTPA-------ANLADVLRYHV 349 A+PSF+ F LL S+ +A +LA+RSSLTLLAVPN+ L +P+ A++ADVLRYHV Sbjct: 42 AFPSFADFARLLESSPVAGELAARSSLTLLAVPNNNLPRSPSAFAAASGADIADVLRYHV 101 Query: 350 LLEYLS 367 LLEYLS Sbjct: 102 LLEYLS 107 >gb|EEC71769.1| hypothetical protein OsI_04379 [Oryza sativa Indica Group] Length = 427 Score = 70.9 bits (172), Expect = 2e-10 Identities = 39/66 (59%), Positives = 50/66 (75%), Gaps = 7/66 (10%) Frame = +2 Query: 191 AYPSFSAFNSLLSSTGIAADLASRSSLTLLAVPNSFLRPTPA-------ANLADVLRYHV 349 A+PSF+ F LL S+ +A +LA+RSSLTLLAVPN+ L +P+ A++ADVLRYHV Sbjct: 42 AFPSFADFARLLESSPVAGELAARSSLTLLAVPNNNLPRSPSAFAAASGADIADVLRYHV 101 Query: 350 LLEYLS 367 LLEYLS Sbjct: 102 LLEYLS 107 >ref|XP_002283909.1| PREDICTED: fasciclin-like arabinogalactan protein 4 [Vitis vinifera] Length = 425 Score = 70.9 bits (172), Expect = 2e-10 Identities = 38/64 (59%), Positives = 47/64 (73%), Gaps = 6/64 (9%) Frame = +2 Query: 194 YPSFSAFNSLLSSTGIAADLASRSSLTLLAVPNSFLRP------TPAANLADVLRYHVLL 355 YP S F +LL++T + DL RSSLTLLAVPNSFLR + A++LADV+RYHVLL Sbjct: 38 YPDLSDFANLLTATAVDGDLIHRSSLTLLAVPNSFLRSSDLTHRSSASSLADVIRYHVLL 97 Query: 356 EYLS 367 +YLS Sbjct: 98 QYLS 101 >emb|CAN72469.1| hypothetical protein VITISV_006797 [Vitis vinifera] Length = 470 Score = 70.9 bits (172), Expect = 2e-10 Identities = 38/64 (59%), Positives = 47/64 (73%), Gaps = 6/64 (9%) Frame = +2 Query: 194 YPSFSAFNSLLSSTGIAADLASRSSLTLLAVPNSFLRP------TPAANLADVLRYHVLL 355 YP S F +LL++T + DL RSSLTLLAVPNSFLR + A++LADV+RYHVLL Sbjct: 38 YPDLSDFANLLTATAVDGDLIHRSSLTLLAVPNSFLRSSDLTHRSSASSLADVIRYHVLL 97 Query: 356 EYLS 367 +YLS Sbjct: 98 QYLS 101 >ref|NP_001044764.1| Os01g0841100 [Oryza sativa Japonica Group] gi|56784671|dbj|BAD81762.1| endosperm specific protein-like [Oryza sativa Japonica Group] gi|113534295|dbj|BAF06678.1| Os01g0841100 [Oryza sativa Japonica Group] gi|215768451|dbj|BAH00680.1| unnamed protein product [Oryza sativa Japonica Group] Length = 427 Score = 70.9 bits (172), Expect = 2e-10 Identities = 39/66 (59%), Positives = 50/66 (75%), Gaps = 7/66 (10%) Frame = +2 Query: 191 AYPSFSAFNSLLSSTGIAADLASRSSLTLLAVPNSFLRPTPA-------ANLADVLRYHV 349 A+PSF+ F LL S+ +A +LA+RSSLTLLAVPN+ L +P+ A++ADVLRYHV Sbjct: 42 AFPSFADFARLLESSPVAGELAARSSLTLLAVPNNNLPRSPSAFAAASGADIADVLRYHV 101 Query: 350 LLEYLS 367 LLEYLS Sbjct: 102 LLEYLS 107 >ref|XP_006644987.1| PREDICTED: fasciclin-like arabinogalactan protein 4-like [Oryza brachyantha] Length = 424 Score = 70.5 bits (171), Expect = 2e-10 Identities = 39/66 (59%), Positives = 50/66 (75%), Gaps = 7/66 (10%) Frame = +2 Query: 191 AYPSFSAFNSLLSSTGIAADLASRSSLTLLAVPNSFLRPTPA-------ANLADVLRYHV 349 A+P FS F LL+S+ +A +LA+RSSLTLLAVPN+ L +P+ A++ADVLRYHV Sbjct: 40 AFPGFSDFARLLASSPVAEELAARSSLTLLAVPNNNLPRSPSAFATASGADIADVLRYHV 99 Query: 350 LLEYLS 367 LLEYLS Sbjct: 100 LLEYLS 105 >ref|XP_006344402.1| PREDICTED: fasciclin-like arabinogalactan protein 4-like [Solanum tuberosum] Length = 426 Score = 70.5 bits (171), Expect = 2e-10 Identities = 38/69 (55%), Positives = 46/69 (66%), Gaps = 10/69 (14%) Frame = +2 Query: 191 AYPSFSAFNSLLSSTGIAADLASRSSLTLLAVPNSFLRPTPAAN----------LADVLR 340 +YP S F +LLS+T +AADLA RSS+TL AVPN+F+R + N L DVLR Sbjct: 39 SYPELSEFTNLLSTTTVAADLAERSSVTLFAVPNTFIRNSDVMNNHSPSSSSISLGDVLR 98 Query: 341 YHVLLEYLS 367 YHVLLEY S Sbjct: 99 YHVLLEYYS 107 >ref|XP_003567260.1| PREDICTED: fasciclin-like arabinogalactan protein 4-like [Brachypodium distachyon] Length = 429 Score = 69.7 bits (169), Expect = 4e-10 Identities = 39/66 (59%), Positives = 49/66 (74%), Gaps = 7/66 (10%) Frame = +2 Query: 191 AYPSFSAFNSLLSSTGIAADLASRSSLTLLAVPNSFLRPTPA-------ANLADVLRYHV 349 A+P+FS F LL+S+ +A +L RSSLTLLAVPN+ L +P+ A+LADVLRYHV Sbjct: 41 AFPNFSDFLRLLTSSPVAGELTGRSSLTLLAVPNANLPRSPSAFAAASGADLADVLRYHV 100 Query: 350 LLEYLS 367 LLEYLS Sbjct: 101 LLEYLS 106 >ref|XP_004241229.1| PREDICTED: fasciclin-like arabinogalactan protein 4-like [Solanum lycopersicum] Length = 421 Score = 69.3 bits (168), Expect = 5e-10 Identities = 37/70 (52%), Positives = 46/70 (65%), Gaps = 11/70 (15%) Frame = +2 Query: 191 AYPSFSAFNSLLSSTGIAADLASRSSLTLLAVPNSFLR-----------PTPAANLADVL 337 +YP S F +L ++T +AADL RSSLTLL VPN+FLR + ++NL DVL Sbjct: 39 SYPEISDFANLFATTSVAADLTQRSSLTLLVVPNTFLRSSDLLNNRSPPSSSSSNLGDVL 98 Query: 338 RYHVLLEYLS 367 RYHVLLEY S Sbjct: 99 RYHVLLEYFS 108 >tpg|DAA56901.1| TPA: hypothetical protein ZEAMMB73_426702 [Zea mays] Length = 682 Score = 69.3 bits (168), Expect = 5e-10 Identities = 37/65 (56%), Positives = 50/65 (76%), Gaps = 7/65 (10%) Frame = +2 Query: 191 AYPSFSAFNSLLSSTGIAADLASRSSLTLLAVPNSFLRPTPA-------ANLADVLRYHV 349 A+P+F+ F LL+ST +A++L+ RSSLTLLAVPN+ L +P+ A++ADVLRYHV Sbjct: 44 AFPNFADFARLLASTPVASELSGRSSLTLLAVPNANLPQSPSAFVASAGADIADVLRYHV 103 Query: 350 LLEYL 364 LLEYL Sbjct: 104 LLEYL 108