BLASTX nr result
ID: Mentha29_contig00033774
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00033774 (429 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU22840.1| hypothetical protein MIMGU_mgv1a000395mg [Mimulus... 41 7e-08 ref|XP_004237983.1| PREDICTED: ATPase family AAA domain-containi... 44 8e-07 ref|XP_006338077.1| PREDICTED: ATPase family AAA domain-containi... 44 1e-06 >gb|EYU22840.1| hypothetical protein MIMGU_mgv1a000395mg [Mimulus guttatus] Length = 1188 Score = 41.2 bits (95), Expect(2) = 7e-08 Identities = 20/25 (80%), Positives = 22/25 (88%) Frame = -2 Query: 227 QLKAVLRMLFEELPCDLPILLLGTS 153 QL+AVL+ L EELP DLPILLLGTS Sbjct: 772 QLRAVLQTLLEELPSDLPILLLGTS 796 Score = 40.8 bits (94), Expect(2) = 7e-08 Identities = 20/44 (45%), Positives = 27/44 (61%) Frame = -3 Query: 136 CDSTSSFSHNHVLHSSSPSRAVESLFSDHVIEATSTIECHNAIK 5 CD+ S FS +VLH SSPS SLF D +IEA +++ +K Sbjct: 804 CDNPSIFSDRNVLHLSSPSTEDRSLFFDRLIEAALSVQSELRVK 847 >ref|XP_004237983.1| PREDICTED: ATPase family AAA domain-containing protein At1g05910-like [Solanum lycopersicum] Length = 1194 Score = 43.5 bits (101), Expect(2) = 8e-07 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -2 Query: 227 QLKAVLRMLFEELPCDLPILLLGTSCV 147 QLKAVLR L EELP DLPILL GTS V Sbjct: 777 QLKAVLRTLLEELPSDLPILLFGTSSV 803 Score = 35.0 bits (79), Expect(2) = 8e-07 Identities = 19/51 (37%), Positives = 29/51 (56%) Frame = -3 Query: 154 PVCNM*CDSTSSFSHNHVLHSSSPSRAVESLFSDHVIEATSTIECHNAIKK 2 P+ ++ + +S FSH+ +L SPS SLF D +IEA +I+ KK Sbjct: 804 PLSDLPDEPSSVFSHHSILCLDSPSDEDRSLFFDRLIEAALSIQVEATTKK 854 >ref|XP_006338077.1| PREDICTED: ATPase family AAA domain-containing protein At1g05910-like isoform X1 [Solanum tuberosum] gi|565341839|ref|XP_006338078.1| PREDICTED: ATPase family AAA domain-containing protein At1g05910-like isoform X2 [Solanum tuberosum] Length = 1194 Score = 43.5 bits (101), Expect(2) = 1e-06 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -2 Query: 227 QLKAVLRMLFEELPCDLPILLLGTSCV 147 QLKAVLR L EELP DLPILL GTS V Sbjct: 777 QLKAVLRTLLEELPSDLPILLFGTSSV 803 Score = 34.3 bits (77), Expect(2) = 1e-06 Identities = 19/51 (37%), Positives = 29/51 (56%) Frame = -3 Query: 154 PVCNM*CDSTSSFSHNHVLHSSSPSRAVESLFSDHVIEATSTIECHNAIKK 2 P+ ++ + +S FSH+ +L SPS SLF D +IEA +I+ KK Sbjct: 804 PLSDLPDEPSSVFSHHCILCLDSPSDEDRSLFFDRLIEAALSIQVEATTKK 854