BLASTX nr result
ID: Mentha29_contig00033679
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00033679 (201 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU38510.1| hypothetical protein MIMGU_mgv1a011011mg [Mimulus... 70 4e-10 >gb|EYU38510.1| hypothetical protein MIMGU_mgv1a011011mg [Mimulus guttatus] Length = 295 Score = 69.7 bits (169), Expect = 4e-10 Identities = 39/66 (59%), Positives = 44/66 (66%) Frame = -2 Query: 200 ASENHSLDLNLSIAPPEKAPWQIHNTEAGSFQVNCGSNNLPESRLKGSASASVAAQLSHE 21 A + H LDLNL IAPP +A Q N E GSFQ+ GSNNLPE+ KGSASAS+ LSH Sbjct: 168 AGDYHDLDLNLGIAPPNRANGQTQNIEMGSFQIYRGSNNLPENGPKGSASASM-EHLSHG 226 Query: 20 PRTVSE 3 R V E Sbjct: 227 HRNVYE 232