BLASTX nr result
ID: Mentha29_contig00033641
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00033641 (432 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXC19700.1| putative GTP-binding protein [Morus notabilis] 56 6e-06 ref|XP_007048142.1| Ras-related small GTP-binding family protein... 56 6e-06 ref|XP_002307133.1| hypothetical protein POPTR_0005s08710g [Popu... 56 6e-06 ref|XP_006367391.1| PREDICTED: uncharacterized GTP-binding prote... 55 8e-06 ref|XP_006427983.1| hypothetical protein CICLE_v10026038mg [Citr... 55 8e-06 ref|XP_006427982.1| hypothetical protein CICLE_v10026038mg [Citr... 55 8e-06 ref|XP_006427981.1| hypothetical protein CICLE_v10026038mg [Citr... 55 8e-06 ref|XP_004237466.1| PREDICTED: uncharacterized GTP-binding prote... 55 8e-06 ref|XP_002310606.1| hypothetical protein POPTR_0007s06690g [Popu... 55 8e-06 >gb|EXC19700.1| putative GTP-binding protein [Morus notabilis] Length = 324 Score = 55.8 bits (133), Expect = 6e-06 Identities = 23/31 (74%), Positives = 28/31 (90%) Frame = +1 Query: 340 MFWRERSRDNREENGVPPSGQVRVLIVGDSG 432 MFWRER R+++E+NG PP GQVRVL+VGDSG Sbjct: 1 MFWRERERESKEQNGGPPCGQVRVLVVGDSG 31 >ref|XP_007048142.1| Ras-related small GTP-binding family protein [Theobroma cacao] gi|508700403|gb|EOX92299.1| Ras-related small GTP-binding family protein [Theobroma cacao] Length = 351 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/31 (77%), Positives = 27/31 (87%) Frame = +1 Query: 340 MFWRERSRDNREENGVPPSGQVRVLIVGDSG 432 MFWRER R+N+E NG PP GQVRVL+VGDSG Sbjct: 1 MFWRERERENKELNGGPPCGQVRVLVVGDSG 31 >ref|XP_002307133.1| hypothetical protein POPTR_0005s08710g [Populus trichocarpa] gi|222856582|gb|EEE94129.1| hypothetical protein POPTR_0005s08710g [Populus trichocarpa] Length = 336 Score = 55.8 bits (133), Expect = 6e-06 Identities = 23/31 (74%), Positives = 28/31 (90%) Frame = +1 Query: 340 MFWRERSRDNREENGVPPSGQVRVLIVGDSG 432 MFWR+R R+N+++NG PP GQVRVLIVGDSG Sbjct: 1 MFWRDRERENKDQNGGPPCGQVRVLIVGDSG 31 >ref|XP_006367391.1| PREDICTED: uncharacterized GTP-binding protein At5g64813-like [Solanum tuberosum] Length = 334 Score = 55.5 bits (132), Expect = 8e-06 Identities = 23/31 (74%), Positives = 27/31 (87%) Frame = +1 Query: 340 MFWRERSRDNREENGVPPSGQVRVLIVGDSG 432 MFWRER R+ +E+NG PP GQVRVL+VGDSG Sbjct: 2 MFWRERERETKEQNGGPPCGQVRVLVVGDSG 32 >ref|XP_006427983.1| hypothetical protein CICLE_v10026038mg [Citrus clementina] gi|568819926|ref|XP_006464491.1| PREDICTED: uncharacterized GTP-binding protein At5g64813-like [Citrus sinensis] gi|557529973|gb|ESR41223.1| hypothetical protein CICLE_v10026038mg [Citrus clementina] Length = 333 Score = 55.5 bits (132), Expect = 8e-06 Identities = 23/31 (74%), Positives = 28/31 (90%) Frame = +1 Query: 340 MFWRERSRDNREENGVPPSGQVRVLIVGDSG 432 MFW+ER R+N+E NG PP+GQVRVL+VGDSG Sbjct: 1 MFWKERERENKELNGGPPTGQVRVLVVGDSG 31 >ref|XP_006427982.1| hypothetical protein CICLE_v10026038mg [Citrus clementina] gi|557529972|gb|ESR41222.1| hypothetical protein CICLE_v10026038mg [Citrus clementina] Length = 262 Score = 55.5 bits (132), Expect = 8e-06 Identities = 23/31 (74%), Positives = 28/31 (90%) Frame = +1 Query: 340 MFWRERSRDNREENGVPPSGQVRVLIVGDSG 432 MFW+ER R+N+E NG PP+GQVRVL+VGDSG Sbjct: 1 MFWKERERENKELNGGPPTGQVRVLVVGDSG 31 >ref|XP_006427981.1| hypothetical protein CICLE_v10026038mg [Citrus clementina] gi|557529971|gb|ESR41221.1| hypothetical protein CICLE_v10026038mg [Citrus clementina] Length = 218 Score = 55.5 bits (132), Expect = 8e-06 Identities = 23/31 (74%), Positives = 28/31 (90%) Frame = +1 Query: 340 MFWRERSRDNREENGVPPSGQVRVLIVGDSG 432 MFW+ER R+N+E NG PP+GQVRVL+VGDSG Sbjct: 1 MFWKERERENKELNGGPPTGQVRVLVVGDSG 31 >ref|XP_004237466.1| PREDICTED: uncharacterized GTP-binding protein At5g64813-like [Solanum lycopersicum] Length = 334 Score = 55.5 bits (132), Expect = 8e-06 Identities = 23/31 (74%), Positives = 27/31 (87%) Frame = +1 Query: 340 MFWRERSRDNREENGVPPSGQVRVLIVGDSG 432 MFWRER R+ +E+NG PP GQVRVL+VGDSG Sbjct: 2 MFWRERERETKEQNGGPPCGQVRVLVVGDSG 32 >ref|XP_002310606.1| hypothetical protein POPTR_0007s06690g [Populus trichocarpa] gi|222853509|gb|EEE91056.1| hypothetical protein POPTR_0007s06690g [Populus trichocarpa] Length = 336 Score = 55.5 bits (132), Expect = 8e-06 Identities = 22/31 (70%), Positives = 28/31 (90%) Frame = +1 Query: 340 MFWRERSRDNREENGVPPSGQVRVLIVGDSG 432 MFWR+R R+N+++NG PP GQVRVL+VGDSG Sbjct: 1 MFWRDRERENKDQNGGPPCGQVRVLVVGDSG 31