BLASTX nr result
ID: Mentha29_contig00033530
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00033530 (224 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU30838.1| hypothetical protein MIMGU_mgv1a007822mg [Mimulus... 119 4e-25 ref|XP_002306421.2| auxin efflux carrier family protein [Populus... 118 8e-25 gb|EPS57973.1| hypothetical protein M569_16844, partial [Genlise... 118 1e-24 gb|EXB95111.1| putative transporter [Morus notabilis] 117 2e-24 ref|XP_006388075.1| hypothetical protein POPTR_0365s00230g [Popu... 117 2e-24 ref|XP_002521739.1| auxin:hydrogen symporter, putative [Ricinus ... 116 4e-24 ref|XP_004232583.1| PREDICTED: uncharacterized transporter YBR28... 115 5e-24 ref|XP_007046466.1| Auxin efflux carrier family protein isoform ... 115 6e-24 ref|XP_007046465.1| Auxin efflux carrier family protein isoform ... 115 6e-24 ref|XP_004159743.1| PREDICTED: uncharacterized transporter YBR28... 114 2e-23 ref|XP_002276744.2| PREDICTED: uncharacterized transporter YBR28... 113 3e-23 emb|CAN62432.1| hypothetical protein VITISV_012649 [Vitis vinifera] 113 3e-23 dbj|BAH19704.1| AT2G17500 [Arabidopsis thaliana] 112 5e-23 ref|NP_565417.1| auxin efflux carrier family protein [Arabidopsi... 112 5e-23 gb|AAM60930.1| unknown [Arabidopsis thaliana] 112 5e-23 ref|XP_002884062.1| auxin efflux carrier family protein [Arabido... 112 7e-23 ref|XP_003578612.1| PREDICTED: uncharacterized transporter YBR28... 111 1e-22 ref|XP_006299821.1| hypothetical protein CARUB_v10016022mg [Caps... 110 2e-22 ref|XP_006855674.1| hypothetical protein AMTR_s00044p00126910 [A... 110 2e-22 ref|XP_006343325.1| PREDICTED: uncharacterized transporter YBR28... 110 3e-22 >gb|EYU30838.1| hypothetical protein MIMGU_mgv1a007822mg [Mimulus guttatus] Length = 394 Score = 119 bits (298), Expect = 4e-25 Identities = 53/74 (71%), Positives = 63/74 (85%) Frame = +1 Query: 1 KYMNKIVYVAFTPSLVFASLAKTVNFEDIISWWFMPVNIGLTFLFGASFGWIVVKVLRPE 180 K +NKIV+VAFTPSLVF SLA+TV +DIISWWFMPVNI +TFL G FGWI K+L+PE Sbjct: 41 KSLNKIVFVAFTPSLVFGSLAETVTLQDIISWWFMPVNIAITFLVGGIFGWIAAKILKPE 100 Query: 181 PYIQNLILAICSAG 222 PY+Q+LI+AICS G Sbjct: 101 PYLQDLIVAICSGG 114 >ref|XP_002306421.2| auxin efflux carrier family protein [Populus trichocarpa] gi|566170511|ref|XP_006382977.1| hypothetical protein POPTR_0005s10230g [Populus trichocarpa] gi|566170513|ref|XP_006382978.1| hypothetical protein POPTR_0005s10230g [Populus trichocarpa] gi|566170515|ref|XP_006382979.1| hypothetical protein POPTR_0005s10230g [Populus trichocarpa] gi|550338531|gb|EEE93417.2| auxin efflux carrier family protein [Populus trichocarpa] gi|550338532|gb|ERP60774.1| hypothetical protein POPTR_0005s10230g [Populus trichocarpa] gi|550338533|gb|ERP60775.1| hypothetical protein POPTR_0005s10230g [Populus trichocarpa] gi|550338534|gb|ERP60776.1| hypothetical protein POPTR_0005s10230g [Populus trichocarpa] Length = 418 Score = 118 bits (296), Expect = 8e-25 Identities = 51/74 (68%), Positives = 64/74 (86%) Frame = +1 Query: 1 KYMNKIVYVAFTPSLVFASLAKTVNFEDIISWWFMPVNIGLTFLFGASFGWIVVKVLRPE 180 K +NK+V++ FTPSL+FASLAKTV EDIISWWFMPVNIGLTFL G GWI+VK+LRP+ Sbjct: 41 KSLNKLVFMVFTPSLMFASLAKTVTLEDIISWWFMPVNIGLTFLIGGILGWILVKILRPK 100 Query: 181 PYIQNLILAICSAG 222 PY++ L++A CS+G Sbjct: 101 PYLEGLVIATCSSG 114 >gb|EPS57973.1| hypothetical protein M569_16844, partial [Genlisea aurea] Length = 425 Score = 118 bits (295), Expect = 1e-24 Identities = 50/74 (67%), Positives = 64/74 (86%) Frame = +1 Query: 1 KYMNKIVYVAFTPSLVFASLAKTVNFEDIISWWFMPVNIGLTFLFGASFGWIVVKVLRPE 180 K +NKIV+ FTPSL+FASL KTV EDIISWWFMPVNI +TF+ G SFGWI +K++RP+ Sbjct: 39 KSLNKIVFAVFTPSLLFASLLKTVRIEDIISWWFMPVNIAITFIVGGSFGWIAMKIIRPK 98 Query: 181 PYIQNLILAICSAG 222 PYIQN+I+A+C++G Sbjct: 99 PYIQNVIIAMCASG 112 >gb|EXB95111.1| putative transporter [Morus notabilis] Length = 426 Score = 117 bits (292), Expect = 2e-24 Identities = 51/74 (68%), Positives = 62/74 (83%) Frame = +1 Query: 1 KYMNKIVYVAFTPSLVFASLAKTVNFEDIISWWFMPVNIGLTFLFGASFGWIVVKVLRPE 180 K +NKIV+ FTPSLVFASLAK V EDIISWWFMPVN+G TFLFG GWI+VK+LRP+ Sbjct: 41 KSLNKIVFAVFTPSLVFASLAKAVTLEDIISWWFMPVNVGFTFLFGGILGWILVKILRPK 100 Query: 181 PYIQNLILAICSAG 222 P+++ LI+A CS+G Sbjct: 101 PHLEGLIIATCSSG 114 >ref|XP_006388075.1| hypothetical protein POPTR_0365s00230g [Populus trichocarpa] gi|550309392|gb|ERP46989.1| hypothetical protein POPTR_0365s00230g [Populus trichocarpa] Length = 428 Score = 117 bits (292), Expect = 2e-24 Identities = 50/74 (67%), Positives = 63/74 (85%) Frame = +1 Query: 1 KYMNKIVYVAFTPSLVFASLAKTVNFEDIISWWFMPVNIGLTFLFGASFGWIVVKVLRPE 180 K +NK+V++ FTPSL+FASLAKTV EDIISWWFMPVNIG TFL G GWI+VK+LRP+ Sbjct: 41 KSLNKLVFMVFTPSLMFASLAKTVTLEDIISWWFMPVNIGFTFLIGGILGWILVKILRPK 100 Query: 181 PYIQNLILAICSAG 222 PY++ L++A CS+G Sbjct: 101 PYLEGLVIATCSSG 114 >ref|XP_002521739.1| auxin:hydrogen symporter, putative [Ricinus communis] gi|223539130|gb|EEF40726.1| auxin:hydrogen symporter, putative [Ricinus communis] Length = 406 Score = 116 bits (290), Expect = 4e-24 Identities = 49/74 (66%), Positives = 64/74 (86%) Frame = +1 Query: 1 KYMNKIVYVAFTPSLVFASLAKTVNFEDIISWWFMPVNIGLTFLFGASFGWIVVKVLRPE 180 K +NKIV+V FTPSL+FASLA+TV +DIISWWFMPVN+GLTFL G GW++VKVL+P+ Sbjct: 41 KSLNKIVFVVFTPSLMFASLAQTVTLQDIISWWFMPVNVGLTFLIGGILGWVLVKVLKPK 100 Query: 181 PYIQNLILAICSAG 222 PY++ L++A CS+G Sbjct: 101 PYLEGLVIATCSSG 114 >ref|XP_004232583.1| PREDICTED: uncharacterized transporter YBR287W-like [Solanum lycopersicum] Length = 405 Score = 115 bits (289), Expect = 5e-24 Identities = 47/74 (63%), Positives = 66/74 (89%) Frame = +1 Query: 1 KYMNKIVYVAFTPSLVFASLAKTVNFEDIISWWFMPVNIGLTFLFGASFGWIVVKVLRPE 180 KY+N+IV+V FTP+L+FASLA++V F+DII+WWFMPVN+GLTFLFG GWI +K+L+P+ Sbjct: 41 KYLNRIVFVIFTPALMFASLAESVTFQDIITWWFMPVNVGLTFLFGGILGWIAMKILKPK 100 Query: 181 PYIQNLILAICSAG 222 P+++ LI+A CS+G Sbjct: 101 PHLEGLIIATCSSG 114 >ref|XP_007046466.1| Auxin efflux carrier family protein isoform 2 [Theobroma cacao] gi|508698727|gb|EOX90623.1| Auxin efflux carrier family protein isoform 2 [Theobroma cacao] Length = 421 Score = 115 bits (288), Expect = 6e-24 Identities = 50/72 (69%), Positives = 63/72 (87%) Frame = +1 Query: 7 MNKIVYVAFTPSLVFASLAKTVNFEDIISWWFMPVNIGLTFLFGASFGWIVVKVLRPEPY 186 +NK+V+V FTPSL+FASLAKTV +DIISWWFMPVNIG+TFL G GWIVVK+LRP+P+ Sbjct: 43 LNKLVFVVFTPSLMFASLAKTVTLQDIISWWFMPVNIGITFLVGGIVGWIVVKILRPKPH 102 Query: 187 IQNLILAICSAG 222 ++ LI+A CS+G Sbjct: 103 LEGLIIATCSSG 114 >ref|XP_007046465.1| Auxin efflux carrier family protein isoform 1 [Theobroma cacao] gi|508698726|gb|EOX90622.1| Auxin efflux carrier family protein isoform 1 [Theobroma cacao] Length = 420 Score = 115 bits (288), Expect = 6e-24 Identities = 50/72 (69%), Positives = 63/72 (87%) Frame = +1 Query: 7 MNKIVYVAFTPSLVFASLAKTVNFEDIISWWFMPVNIGLTFLFGASFGWIVVKVLRPEPY 186 +NK+V+V FTPSL+FASLAKTV +DIISWWFMPVNIG+TFL G GWIVVK+LRP+P+ Sbjct: 43 LNKLVFVVFTPSLMFASLAKTVTLQDIISWWFMPVNIGITFLVGGIVGWIVVKILRPKPH 102 Query: 187 IQNLILAICSAG 222 ++ LI+A CS+G Sbjct: 103 LEGLIIATCSSG 114 >ref|XP_004159743.1| PREDICTED: uncharacterized transporter YBR287W-like [Cucumis sativus] Length = 412 Score = 114 bits (284), Expect = 2e-23 Identities = 48/72 (66%), Positives = 62/72 (86%) Frame = +1 Query: 7 MNKIVYVAFTPSLVFASLAKTVNFEDIISWWFMPVNIGLTFLFGASFGWIVVKVLRPEPY 186 +NKIV+ FTP L+FA+LAKTV F+DI+SWWFMPVNIGLTFLFG GWIVVK+L+P+PY Sbjct: 43 LNKIVFTVFTPCLMFANLAKTVTFQDIVSWWFMPVNIGLTFLFGGILGWIVVKILKPKPY 102 Query: 187 IQNLILAICSAG 222 ++ L++A S+G Sbjct: 103 LEGLVIAASSSG 114 >ref|XP_002276744.2| PREDICTED: uncharacterized transporter YBR287W-like [Vitis vinifera] gi|296082565|emb|CBI21570.3| unnamed protein product [Vitis vinifera] Length = 421 Score = 113 bits (282), Expect = 3e-23 Identities = 49/74 (66%), Positives = 64/74 (86%) Frame = +1 Query: 1 KYMNKIVYVAFTPSLVFASLAKTVNFEDIISWWFMPVNIGLTFLFGASFGWIVVKVLRPE 180 K +NKIV+VAFTPSL+FA LA+TV +D+ISWWFMPVNIGLTFLFG GW+VVK+L+P+ Sbjct: 41 KSVNKIVFVAFTPSLMFAGLAQTVTLQDMISWWFMPVNIGLTFLFGGILGWLVVKILKPK 100 Query: 181 PYIQNLILAICSAG 222 +++ LI+A CS+G Sbjct: 101 QHLEGLIMATCSSG 114 >emb|CAN62432.1| hypothetical protein VITISV_012649 [Vitis vinifera] Length = 436 Score = 113 bits (282), Expect = 3e-23 Identities = 49/74 (66%), Positives = 64/74 (86%) Frame = +1 Query: 1 KYMNKIVYVAFTPSLVFASLAKTVNFEDIISWWFMPVNIGLTFLFGASFGWIVVKVLRPE 180 K +NKIV+VAFTPSL+FA LA+TV +D+ISWWFMPVNIGLTFLFG GW+VVK+L+P+ Sbjct: 56 KSVNKIVFVAFTPSLMFAGLAQTVTLQDMISWWFMPVNIGLTFLFGGILGWLVVKILKPK 115 Query: 181 PYIQNLILAICSAG 222 +++ LI+A CS+G Sbjct: 116 QHLEGLIMATCSSG 129 >dbj|BAH19704.1| AT2G17500 [Arabidopsis thaliana] Length = 210 Score = 112 bits (280), Expect = 5e-23 Identities = 48/72 (66%), Positives = 61/72 (84%) Frame = +1 Query: 7 MNKIVYVAFTPSLVFASLAKTVNFEDIISWWFMPVNIGLTFLFGASFGWIVVKVLRPEPY 186 MNK+V+V F P+L+FA+LA+TV EDIISWWFMPVN+GLTFL G GW+VVK+L+P PY Sbjct: 43 MNKVVFVLFAPALMFANLAQTVTLEDIISWWFMPVNMGLTFLIGGLLGWLVVKILKPPPY 102 Query: 187 IQNLILAICSAG 222 ++ LI+A CSAG Sbjct: 103 LEGLIVATCSAG 114 >ref|NP_565417.1| auxin efflux carrier family protein [Arabidopsis thaliana] gi|30680004|ref|NP_849964.1| auxin efflux carrier family protein [Arabidopsis thaliana] gi|42570811|ref|NP_973479.1| auxin efflux carrier family protein [Arabidopsis thaliana] gi|79322403|ref|NP_001031363.1| auxin efflux carrier family protein [Arabidopsis thaliana] gi|4914371|gb|AAD32907.1| expressed protein [Arabidopsis thaliana] gi|110740748|dbj|BAE98473.1| hypothetical protein [Arabidopsis thaliana] gi|330251540|gb|AEC06634.1| auxin efflux carrier family protein [Arabidopsis thaliana] gi|330251541|gb|AEC06635.1| auxin efflux carrier family protein [Arabidopsis thaliana] gi|330251542|gb|AEC06636.1| auxin efflux carrier family protein [Arabidopsis thaliana] gi|330251543|gb|AEC06637.1| auxin efflux carrier family protein [Arabidopsis thaliana] Length = 396 Score = 112 bits (280), Expect = 5e-23 Identities = 48/72 (66%), Positives = 61/72 (84%) Frame = +1 Query: 7 MNKIVYVAFTPSLVFASLAKTVNFEDIISWWFMPVNIGLTFLFGASFGWIVVKVLRPEPY 186 MNK+V+V F P+L+FA+LA+TV EDIISWWFMPVN+GLTFL G GW+VVK+L+P PY Sbjct: 43 MNKVVFVLFAPALMFANLAQTVTLEDIISWWFMPVNMGLTFLIGGLLGWLVVKILKPPPY 102 Query: 187 IQNLILAICSAG 222 ++ LI+A CSAG Sbjct: 103 LEGLIVATCSAG 114 >gb|AAM60930.1| unknown [Arabidopsis thaliana] Length = 396 Score = 112 bits (280), Expect = 5e-23 Identities = 48/72 (66%), Positives = 61/72 (84%) Frame = +1 Query: 7 MNKIVYVAFTPSLVFASLAKTVNFEDIISWWFMPVNIGLTFLFGASFGWIVVKVLRPEPY 186 MNK+V+V F P+L+FA+LA+TV EDIISWWFMPVN+GLTFL G GW+VVK+L+P PY Sbjct: 43 MNKVVFVLFAPALMFANLAQTVTLEDIISWWFMPVNMGLTFLIGGLLGWLVVKILKPPPY 102 Query: 187 IQNLILAICSAG 222 ++ LI+A CSAG Sbjct: 103 LEGLIVATCSAG 114 >ref|XP_002884062.1| auxin efflux carrier family protein [Arabidopsis lyrata subsp. lyrata] gi|297329902|gb|EFH60321.1| auxin efflux carrier family protein [Arabidopsis lyrata subsp. lyrata] Length = 396 Score = 112 bits (279), Expect = 7e-23 Identities = 48/72 (66%), Positives = 61/72 (84%) Frame = +1 Query: 7 MNKIVYVAFTPSLVFASLAKTVNFEDIISWWFMPVNIGLTFLFGASFGWIVVKVLRPEPY 186 MNK+V+V F P+L+FA+LA+TV EDIISWWFMPVN+GLTFL G GW+VVK+L+P PY Sbjct: 43 MNKVVFVLFAPALMFANLAQTVTLEDIISWWFMPVNMGLTFLIGGLLGWMVVKILKPPPY 102 Query: 187 IQNLILAICSAG 222 ++ LI+A CSAG Sbjct: 103 LEGLIVATCSAG 114 >ref|XP_003578612.1| PREDICTED: uncharacterized transporter YBR287W-like [Brachypodium distachyon] Length = 423 Score = 111 bits (277), Expect = 1e-22 Identities = 47/72 (65%), Positives = 59/72 (81%) Frame = +1 Query: 7 MNKIVYVAFTPSLVFASLAKTVNFEDIISWWFMPVNIGLTFLFGASFGWIVVKVLRPEPY 186 MNK+V+ FTPSL+FASLAKTV D+ISWWFMPVNIG+TFL G + GWIV K+L+P P+ Sbjct: 43 MNKVVFTVFTPSLMFASLAKTVTLSDVISWWFMPVNIGITFLVGGALGWIVCKILKPPPH 102 Query: 187 IQNLILAICSAG 222 + LI++ CSAG Sbjct: 103 FRGLIISFCSAG 114 >ref|XP_006299821.1| hypothetical protein CARUB_v10016022mg [Capsella rubella] gi|482568530|gb|EOA32719.1| hypothetical protein CARUB_v10016022mg [Capsella rubella] Length = 393 Score = 110 bits (276), Expect = 2e-22 Identities = 47/72 (65%), Positives = 61/72 (84%) Frame = +1 Query: 7 MNKIVYVAFTPSLVFASLAKTVNFEDIISWWFMPVNIGLTFLFGASFGWIVVKVLRPEPY 186 MNK+V+V F P+L+FA+LA+TV EDIISWWFMPVN+GLTFL G GW+VVK+L+P PY Sbjct: 43 MNKVVFVLFAPALMFANLAQTVTLEDIISWWFMPVNMGLTFLIGGLLGWMVVKILKPPPY 102 Query: 187 IQNLILAICSAG 222 ++ LI+A CS+G Sbjct: 103 LEGLIVATCSSG 114 >ref|XP_006855674.1| hypothetical protein AMTR_s00044p00126910 [Amborella trichopoda] gi|548859461|gb|ERN17141.1| hypothetical protein AMTR_s00044p00126910 [Amborella trichopoda] Length = 429 Score = 110 bits (275), Expect = 2e-22 Identities = 46/74 (62%), Positives = 61/74 (82%) Frame = +1 Query: 1 KYMNKIVYVAFTPSLVFASLAKTVNFEDIISWWFMPVNIGLTFLFGASFGWIVVKVLRPE 180 +Y+NK+V++ FTPSL+FASL K+V EDI+SWWFMPVNIGL+ FGA GWI VK+ +PE Sbjct: 41 RYINKVVFIVFTPSLMFASLVKSVTLEDIVSWWFMPVNIGLSVFFGAVLGWIAVKITKPE 100 Query: 181 PYIQNLILAICSAG 222 Y++ LI+A CS+G Sbjct: 101 RYLEGLIVASCSSG 114 >ref|XP_006343325.1| PREDICTED: uncharacterized transporter YBR287W-like [Solanum tuberosum] Length = 395 Score = 110 bits (274), Expect = 3e-22 Identities = 47/72 (65%), Positives = 59/72 (81%) Frame = +1 Query: 7 MNKIVYVAFTPSLVFASLAKTVNFEDIISWWFMPVNIGLTFLFGASFGWIVVKVLRPEPY 186 +NKIV+V FTPS+ FASL KTV +DIISWWFMP+NIGLTFL G GW+VVK+L+PE + Sbjct: 43 LNKIVFVVFTPSITFASLTKTVTLDDIISWWFMPINIGLTFLVGGILGWLVVKILKPEVH 102 Query: 187 IQNLILAICSAG 222 ++ LI+A CS G Sbjct: 103 LEGLIIATCSTG 114