BLASTX nr result
ID: Mentha29_contig00033105
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00033105 (285 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU21228.1| hypothetical protein MIMGU_mgv1a023092mg, partial... 73 4e-11 >gb|EYU21228.1| hypothetical protein MIMGU_mgv1a023092mg, partial [Mimulus guttatus] Length = 920 Score = 73.2 bits (178), Expect = 4e-11 Identities = 45/87 (51%), Positives = 57/87 (65%), Gaps = 5/87 (5%) Frame = -2 Query: 284 LAIFLSKFLYENRSILTSDASVKHKIQGLAKAFYQEKDCISKESLRGRV----SAPSPAV 117 L IFLS FLYEN+ IL+S AS+K K+ GL +AF Q+K+ + R V +A SPA+ Sbjct: 832 LTIFLSIFLYENQVILSSGASIKEKLIGLGRAFCQKKNVTKFKESRNDVGMEFAAQSPAI 891 Query: 116 SLSCD-QEGMFSPDEGFSTPETETHIH 39 S+SCD EGM DEGFST E T +H Sbjct: 892 SVSCDHNEGM---DEGFSTTEPGTPLH 915