BLASTX nr result
ID: Mentha29_contig00032781
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00032781 (244 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU29532.1| hypothetical protein MIMGU_mgv1a004570mg [Mimulus... 65 1e-08 >gb|EYU29532.1| hypothetical protein MIMGU_mgv1a004570mg [Mimulus guttatus] Length = 520 Score = 64.7 bits (156), Expect = 1e-08 Identities = 29/38 (76%), Positives = 32/38 (84%) Frame = +3 Query: 3 EGSRKRRVVLSYSDDEDEYENAVSLGSPDPPKKSTQCS 116 EG RKRRVV YSDDEDEY +AVSL SPDPPKKS+ C+ Sbjct: 298 EGGRKRRVVFDYSDDEDEYRDAVSLSSPDPPKKSSLCN 335