BLASTX nr result
ID: Mentha29_contig00032724
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00032724 (272 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003537099.2| PREDICTED: glutathione S-transferase omega-l... 66 4e-09 gb|EPS62322.1| hypothetical protein M569_12468 [Genlisea aurea] 65 1e-08 ref|XP_002526554.1| glutathione transferase, putative [Ricinus c... 65 1e-08 ref|XP_006443748.1| hypothetical protein CICLE_v10020368mg [Citr... 64 3e-08 ref|XP_002320605.2| hypothetical protein POPTR_0014s18800g [Popu... 63 4e-08 ref|NP_568632.1| Glutathione S-transferase family protein [Arabi... 63 4e-08 dbj|BAD44450.1| unknown protein [Arabidopsis thaliana] 63 4e-08 gb|AAM61048.1| unknown [Arabidopsis thaliana] 63 4e-08 ref|XP_006403153.1| hypothetical protein EUTSA_v10003220mg [Eutr... 62 6e-08 dbj|BAB09060.1| unnamed protein product [Arabidopsis thaliana] 62 6e-08 ref|XP_002863619.1| glutathione S-transferase C-terminal domain-... 62 6e-08 ref|XP_002270355.2| PREDICTED: uncharacterized protein yqjG-like... 62 8e-08 ref|XP_007144855.1| hypothetical protein PHAVU_007G189800g [Phas... 62 1e-07 ref|XP_006280535.1| hypothetical protein CARUB_v10026474mg, part... 61 2e-07 ref|XP_004242372.1| PREDICTED: glutathionyl-hydroquinone reducta... 61 2e-07 ref|XP_006352730.1| PREDICTED: glutathione S-transferase omega-l... 60 4e-07 ref|XP_007050183.1| Glutathione S-transferase family protein [Th... 60 4e-07 ref|XP_007199880.1| hypothetical protein PRUPE_ppa006395mg [Prun... 60 4e-07 ref|XP_004495065.1| PREDICTED: glutathionyl-hydroquinone reducta... 59 5e-07 gb|EXB46002.1| hypothetical protein L484_015862 [Morus notabilis] 59 9e-07 >ref|XP_003537099.2| PREDICTED: glutathione S-transferase omega-like 2-like [Glycine max] Length = 401 Score = 66.2 bits (160), Expect = 4e-09 Identities = 27/35 (77%), Positives = 32/35 (91%) Frame = -3 Query: 105 WGQSLPPNLLISTARTAWSAAWHLMMSQLAPSDSA 1 WGQSLPP LL++T RTAW++ WHLMMSQLAPSDS+ Sbjct: 54 WGQSLPPGLLVATVRTAWNSTWHLMMSQLAPSDSS 88 >gb|EPS62322.1| hypothetical protein M569_12468 [Genlisea aurea] Length = 393 Score = 64.7 bits (156), Expect = 1e-08 Identities = 28/35 (80%), Positives = 30/35 (85%) Frame = -3 Query: 105 WGQSLPPNLLISTARTAWSAAWHLMMSQLAPSDSA 1 WG SLPPNLLISTAR WS WH+MMSQLAPSDS+ Sbjct: 49 WGPSLPPNLLISTARLTWSTLWHVMMSQLAPSDSS 83 >ref|XP_002526554.1| glutathione transferase, putative [Ricinus communis] gi|223534115|gb|EEF35832.1| glutathione transferase, putative [Ricinus communis] Length = 435 Score = 64.7 bits (156), Expect = 1e-08 Identities = 28/35 (80%), Positives = 31/35 (88%) Frame = -3 Query: 105 WGQSLPPNLLISTARTAWSAAWHLMMSQLAPSDSA 1 WGQSLPP LLIST RT W++AW LMMSQLAPSDS+ Sbjct: 52 WGQSLPPGLLISTVRTTWNSAWQLMMSQLAPSDSS 86 >ref|XP_006443748.1| hypothetical protein CICLE_v10020368mg [Citrus clementina] gi|568851552|ref|XP_006479454.1| PREDICTED: glutathione S-transferase omega-like 2-like [Citrus sinensis] gi|557546010|gb|ESR56988.1| hypothetical protein CICLE_v10020368mg [Citrus clementina] Length = 414 Score = 63.5 bits (153), Expect = 3e-08 Identities = 27/35 (77%), Positives = 31/35 (88%) Frame = -3 Query: 105 WGQSLPPNLLISTARTAWSAAWHLMMSQLAPSDSA 1 WG SLPP LL+ST RT+W+AAW LMMSQLAPSDS+ Sbjct: 63 WGPSLPPGLLVSTVRTSWNAAWQLMMSQLAPSDSS 97 >ref|XP_002320605.2| hypothetical protein POPTR_0014s18800g [Populus trichocarpa] gi|550324513|gb|EEE98920.2| hypothetical protein POPTR_0014s18800g [Populus trichocarpa] Length = 426 Score = 63.2 bits (152), Expect = 4e-08 Identities = 27/35 (77%), Positives = 30/35 (85%) Frame = -3 Query: 105 WGQSLPPNLLISTARTAWSAAWHLMMSQLAPSDSA 1 WGQSLPP LLIST RT W++ W LMMSQLAPSDS+ Sbjct: 72 WGQSLPPGLLISTVRTTWNSTWQLMMSQLAPSDSS 106 >ref|NP_568632.1| Glutathione S-transferase family protein [Arabidopsis thaliana] gi|98960975|gb|ABF58971.1| At5g44000 [Arabidopsis thaliana] gi|332007663|gb|AED95046.1| Glutathione S-transferase family protein [Arabidopsis thaliana] Length = 399 Score = 63.2 bits (152), Expect = 4e-08 Identities = 32/60 (53%), Positives = 37/60 (61%) Frame = -3 Query: 180 RRLNPTPKMSXXXXXXXXXXXXXXLWGQSLPPNLLISTARTAWSAAWHLMMSQLAPSDSA 1 R + +PK S LWG SLPP LLISTARTAW+ W LMM+QLAPSDS+ Sbjct: 22 RMSHQSPKPSTSTTTSIFTSATKLLWGPSLPPGLLISTARTAWTTVWQLMMTQLAPSDSS 81 >dbj|BAD44450.1| unknown protein [Arabidopsis thaliana] Length = 399 Score = 63.2 bits (152), Expect = 4e-08 Identities = 32/60 (53%), Positives = 37/60 (61%) Frame = -3 Query: 180 RRLNPTPKMSXXXXXXXXXXXXXXLWGQSLPPNLLISTARTAWSAAWHLMMSQLAPSDSA 1 R + +PK S LWG SLPP LLISTARTAW+ W LMM+QLAPSDS+ Sbjct: 22 RMSHQSPKPSTSTTTSIFTSATKLLWGPSLPPGLLISTARTAWTTVWQLMMTQLAPSDSS 81 >gb|AAM61048.1| unknown [Arabidopsis thaliana] Length = 399 Score = 63.2 bits (152), Expect = 4e-08 Identities = 32/60 (53%), Positives = 37/60 (61%) Frame = -3 Query: 180 RRLNPTPKMSXXXXXXXXXXXXXXLWGQSLPPNLLISTARTAWSAAWHLMMSQLAPSDSA 1 R + +PK S LWG SLPP LLISTARTAW+ W LMM+QLAPSDS+ Sbjct: 22 RMSHQSPKPSTSTTTSIFTSATKLLWGPSLPPGLLISTARTAWTTVWQLMMTQLAPSDSS 81 >ref|XP_006403153.1| hypothetical protein EUTSA_v10003220mg [Eutrema salsugineum] gi|557104266|gb|ESQ44606.1| hypothetical protein EUTSA_v10003220mg [Eutrema salsugineum] Length = 406 Score = 62.4 bits (150), Expect = 6e-08 Identities = 27/35 (77%), Positives = 30/35 (85%) Frame = -3 Query: 105 WGQSLPPNLLISTARTAWSAAWHLMMSQLAPSDSA 1 WG SLPP LLISTARTAW+ W LMM+QLAPSDS+ Sbjct: 53 WGPSLPPGLLISTARTAWTTVWQLMMTQLAPSDSS 87 >dbj|BAB09060.1| unnamed protein product [Arabidopsis thaliana] Length = 377 Score = 62.4 bits (150), Expect = 6e-08 Identities = 27/35 (77%), Positives = 30/35 (85%) Frame = -3 Query: 105 WGQSLPPNLLISTARTAWSAAWHLMMSQLAPSDSA 1 WG SLPP LLISTARTAW+ W LMM+QLAPSDS+ Sbjct: 25 WGPSLPPGLLISTARTAWTTVWQLMMTQLAPSDSS 59 >ref|XP_002863619.1| glutathione S-transferase C-terminal domain-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297309454|gb|EFH39878.1| glutathione S-transferase C-terminal domain-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 400 Score = 62.4 bits (150), Expect = 6e-08 Identities = 27/35 (77%), Positives = 30/35 (85%) Frame = -3 Query: 105 WGQSLPPNLLISTARTAWSAAWHLMMSQLAPSDSA 1 WG SLPP LLISTARTAW+ W LMM+QLAPSDS+ Sbjct: 48 WGPSLPPGLLISTARTAWTTVWQLMMTQLAPSDSS 82 >ref|XP_002270355.2| PREDICTED: uncharacterized protein yqjG-like [Vitis vinifera] Length = 408 Score = 62.0 bits (149), Expect = 8e-08 Identities = 26/33 (78%), Positives = 28/33 (84%) Frame = -3 Query: 105 WGQSLPPNLLISTARTAWSAAWHLMMSQLAPSD 7 WG SLPP LLIST R+ WSA WHL+MSQLAPSD Sbjct: 54 WGNSLPPQLLISTVRSTWSATWHLLMSQLAPSD 86 >ref|XP_007144855.1| hypothetical protein PHAVU_007G189800g [Phaseolus vulgaris] gi|561018045|gb|ESW16849.1| hypothetical protein PHAVU_007G189800g [Phaseolus vulgaris] Length = 403 Score = 61.6 bits (148), Expect = 1e-07 Identities = 25/35 (71%), Positives = 31/35 (88%) Frame = -3 Query: 105 WGQSLPPNLLISTARTAWSAAWHLMMSQLAPSDSA 1 WGQSLPP +L++T RTAW++ W LMMSQLAPSDS+ Sbjct: 58 WGQSLPPGILVATVRTAWNSTWGLMMSQLAPSDSS 92 >ref|XP_006280535.1| hypothetical protein CARUB_v10026474mg, partial [Capsella rubella] gi|482549239|gb|EOA13433.1| hypothetical protein CARUB_v10026474mg, partial [Capsella rubella] Length = 421 Score = 60.8 bits (146), Expect = 2e-07 Identities = 25/35 (71%), Positives = 30/35 (85%) Frame = -3 Query: 105 WGQSLPPNLLISTARTAWSAAWHLMMSQLAPSDSA 1 WG SLPP LL++TARTAW+ W LMM+QLAPSDS+ Sbjct: 68 WGPSLPPGLLVTTARTAWTTVWQLMMTQLAPSDSS 102 >ref|XP_004242372.1| PREDICTED: glutathionyl-hydroquinone reductase YqjG-like [Solanum lycopersicum] Length = 412 Score = 60.8 bits (146), Expect = 2e-07 Identities = 32/57 (56%), Positives = 33/57 (57%), Gaps = 2/57 (3%) Frame = -3 Query: 171 NPTPKMSXXXXXXXXXXXXXXL--WGQSLPPNLLISTARTAWSAAWHLMMSQLAPSD 7 N TPKMS WG SLPP LLIST R+ WSA W LMMSQLAPSD Sbjct: 36 NSTPKMSLNQNSNTNLINTITKLLWGPSLPPQLLISTVRSTWSATWQLMMSQLAPSD 92 >ref|XP_006352730.1| PREDICTED: glutathione S-transferase omega-like 2-like [Solanum tuberosum] Length = 414 Score = 59.7 bits (143), Expect = 4e-07 Identities = 26/33 (78%), Positives = 27/33 (81%) Frame = -3 Query: 105 WGQSLPPNLLISTARTAWSAAWHLMMSQLAPSD 7 WG SLPP LLIST R+ WS AW LMMSQLAPSD Sbjct: 62 WGPSLPPQLLISTVRSTWSTAWQLMMSQLAPSD 94 >ref|XP_007050183.1| Glutathione S-transferase family protein [Theobroma cacao] gi|508702444|gb|EOX94340.1| Glutathione S-transferase family protein [Theobroma cacao] Length = 409 Score = 59.7 bits (143), Expect = 4e-07 Identities = 25/33 (75%), Positives = 28/33 (84%) Frame = -3 Query: 105 WGQSLPPNLLISTARTAWSAAWHLMMSQLAPSD 7 WG SLPP LLIST RTAW++ W +MMSQLAPSD Sbjct: 55 WGPSLPPGLLISTVRTAWTSTWQIMMSQLAPSD 87 >ref|XP_007199880.1| hypothetical protein PRUPE_ppa006395mg [Prunus persica] gi|462395280|gb|EMJ01079.1| hypothetical protein PRUPE_ppa006395mg [Prunus persica] Length = 413 Score = 59.7 bits (143), Expect = 4e-07 Identities = 25/33 (75%), Positives = 28/33 (84%) Frame = -3 Query: 105 WGQSLPPNLLISTARTAWSAAWHLMMSQLAPSD 7 WG SLPP LLIST RTAW++ W +MMSQLAPSD Sbjct: 60 WGPSLPPGLLISTVRTAWNSTWRIMMSQLAPSD 92 >ref|XP_004495065.1| PREDICTED: glutathionyl-hydroquinone reductase YqjG-like [Cicer arietinum] Length = 414 Score = 59.3 bits (142), Expect = 5e-07 Identities = 23/34 (67%), Positives = 30/34 (88%) Frame = -3 Query: 105 WGQSLPPNLLISTARTAWSAAWHLMMSQLAPSDS 4 WG+SLPP +L++T RTAW++ W LMMSQ+APSDS Sbjct: 66 WGRSLPPGVLVTTVRTAWNSTWQLMMSQIAPSDS 99 >gb|EXB46002.1| hypothetical protein L484_015862 [Morus notabilis] Length = 382 Score = 58.5 bits (140), Expect = 9e-07 Identities = 25/33 (75%), Positives = 27/33 (81%) Frame = -3 Query: 105 WGQSLPPNLLISTARTAWSAAWHLMMSQLAPSD 7 WG SLPP+ LIST RTAW + W LMMSQLAPSD Sbjct: 24 WGPSLPPDFLISTVRTAWHSTWRLMMSQLAPSD 56