BLASTX nr result
ID: Mentha29_contig00032564
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00032564 (584 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS74704.1| hypothetical protein M569_00079, partial [Genlise... 69 9e-10 >gb|EPS74704.1| hypothetical protein M569_00079, partial [Genlisea aurea] Length = 88 Score = 68.9 bits (167), Expect = 9e-10 Identities = 37/61 (60%), Positives = 45/61 (73%), Gaps = 1/61 (1%) Frame = -2 Query: 244 VWYLTGH*NRTEPLVRLLFS*SYYGVRHRFLNKIHF-LDCMVDSPEKHWRACKRVALPTE 68 V++ GH NRT+P V LLFS SY GVRHR ++I + M++SPEK WRACKR ALPTE Sbjct: 29 VYFCFGHSNRTKPFVMLLFSQSY-GVRHRLQDQISIDFEWMMESPEKPWRACKRGALPTE 87 Query: 67 L 65 L Sbjct: 88 L 88