BLASTX nr result
ID: Mentha29_contig00032424
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00032424 (365 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002535451.1| conserved hypothetical protein [Ricinus comm... 90 4e-16 ref|XP_002523280.1| conserved hypothetical protein [Ricinus comm... 78 1e-12 >ref|XP_002535451.1| conserved hypothetical protein [Ricinus communis] gi|223523062|gb|EEF26930.1| conserved hypothetical protein [Ricinus communis] Length = 115 Score = 89.7 bits (221), Expect = 4e-16 Identities = 44/46 (95%), Positives = 44/46 (95%) Frame = -2 Query: 139 RGVSTSLARGWDSFTCILASTTKSSGLNAPTTAVQPFLGFVESGFP 2 RGVSTSLARGWDSFTCI ASTTKSSGLNA TTAVQPFLGFVESGFP Sbjct: 20 RGVSTSLARGWDSFTCIPASTTKSSGLNALTTAVQPFLGFVESGFP 65 >ref|XP_002523280.1| conserved hypothetical protein [Ricinus communis] gi|223537493|gb|EEF39119.1| conserved hypothetical protein [Ricinus communis] Length = 77 Score = 77.8 bits (190), Expect = 1e-12 Identities = 38/45 (84%), Positives = 39/45 (86%) Frame = -2 Query: 136 GVSTSLARGWDSFTCILASTTKSSGLNAPTTAVQPFLGFVESGFP 2 G STSLARGWDSFTCI ASTTKSS LNA TT VQPFL F+ESGFP Sbjct: 24 GRSTSLARGWDSFTCISASTTKSSSLNALTTLVQPFLEFIESGFP 68