BLASTX nr result
ID: Mentha29_contig00032418
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00032418 (482 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN78588.1| hypothetical protein VITISV_043911 [Vitis vinifera] 58 2e-06 emb|CAN62774.1| hypothetical protein VITISV_019970 [Vitis vinifera] 57 3e-06 >emb|CAN78588.1| hypothetical protein VITISV_043911 [Vitis vinifera] Length = 2232 Score = 57.8 bits (138), Expect = 2e-06 Identities = 28/65 (43%), Positives = 40/65 (61%), Gaps = 2/65 (3%) Frame = -2 Query: 481 FPQSPSNAFY*GIRSC--DGVQESWSQDPVRVPRGPVTRARAKKFKEALQGLIQEVWAQE 308 F +SP N +C +G W+ +P++VP G VTRARAKKFKE L GLI ++W + Sbjct: 2106 FLESPKN-------TCXDEGTTNKWNABPIQVPVGSVTRARAKKFKETLNGLIXKIWVEX 2158 Query: 307 LMKKP 293 + +P Sbjct: 2159 NLWRP 2163 >emb|CAN62774.1| hypothetical protein VITISV_019970 [Vitis vinifera] Length = 524 Score = 56.6 bits (135), Expect = 3e-06 Identities = 24/41 (58%), Positives = 31/41 (75%) Frame = -2 Query: 433 DGVQESWSQDPVRVPRGPVTRARAKKFKEALQGLIQEVWAQ 311 +G+ W+ P++V GPVTRARAKKFKE L GLIQ +WA+ Sbjct: 459 EGMTNKWNATPIQVLVGPVTRARAKKFKETLNGLIQNIWAK 499